DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowah and trpa-1

DIOPT Version :9

Sequence 1:NP_001137943.2 Gene:sowah / 39438 FlyBaseID:FBgn0036302 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_502249.3 Gene:trpa-1 / 178118 WormBaseID:WBGene00007801 Length:1211 Species:Caenorhabditis elegans


Alignment Length:353 Identity:81/353 - (22%)
Similarity:120/353 - (33%) Gaps:89/353 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 NPISVKEATRKFNRMASEEEAKIISPPAKKKPEKQLIEEKDSPEVTLAHPKAKEWIVSMAKANYQ 294
            :|:...:|...||.             .||.|.:..:|..        ||:..:.|:.|.|.|  
 Worm   263 DPVEAIKALNLFNN-------------EKKTPLRMAVEGN--------HPETLKKILQMEKKN-- 304

  Fly   295 ELAKMASEYPELVKLQCPATGYTALHWAAKHGNEDVVKLI--AGTYKADVNARTNGGYTPLHLAT 357
             ..|......||:            |:||:.|..:|:|.:  ||..|.::|   .....|||:|.
 Worm   305 -SCKWMDREKELI------------HFAAEKGFLEVLKALVEAGGNKNELN---EVKAVPLHVAA 353

  Fly   358 QFGRDNIFELLWNVYKANRDIMDWSGNKPL------------DYSRQRSSVSASTCSSEYAKYFF 410
            |..:..:...|....|.|.|::|..|..||            :|...:.:....|...|....|.
 Worm   354 QMNQLEVVSYLIEEEKDNIDVVDEQGLTPLMMAVTHDSKKCVEYLIAKKANLTITDKDERTPVFI 418

  Fly   411 GADVGNSFRTLGFIESSQITGGTLGSALTRGKKRAQNRFATISGGSLGGVGGAVSRSQSMTVSRR 475
            ||    .|..|..:|.      .|.....:.|:..::...:.:..:|..|...|.|:....|.| 
 Worm   419 GA----KFNALSSVEY------ILDHLRKKNKETERSALKSPTRNTLRIVSEDVRRTMVNMVDR- 472

  Fly   476 PKKQPGQPISGIFKPATEDGDLLPCEMEGQPVPFRGAS-TRRKESFLRKTFRATAGGS------- 532
               ....|:..:    ..:|.|   ||. |.:...||| |:..|.......||..||.       
 Worm   473 ---DQNTPMHIV----ASNGYL---EMM-QLLQKHGASITQVNEDEETALHRAAIGGQTGAVRQL 526

  Fly   533 -----RRPLAKDVFTNPPEHEIKARKKH 555
                 |..|.||...|...| :.||..|
 Worm   527 LEWDIRLLLMKDEMGNSALH-LAARSGH 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowahNP_001137943.2 Ank_4 289..333 CDD:290365 10/43 (23%)
ANK <315..393 CDD:238125 24/91 (26%)
Ank_4 315..368 CDD:290365 15/54 (28%)
ANK repeat 315..346 CDD:293786 10/32 (31%)
ANK repeat 348..380 CDD:293786 9/31 (29%)
trpa-1NP_502249.3 Ank_4 51..104 CDD:290365
ANK repeat 51..81 CDD:293786
ANK 78..227 CDD:238125
ANK repeat 86..114 CDD:293786
Ank_2 88..204 CDD:289560
ANK repeat 116..171 CDD:293786
ANK 168..298 CDD:238125 10/55 (18%)
ANK repeat 173..204 CDD:293786
ANK repeat 206..237 CDD:293786
Ank_4 208..258 CDD:290365
Ank_2 244..342 CDD:289560 26/114 (23%)
ANK repeat 280..310 CDD:293786 9/40 (23%)
Ank_2 316..409 CDD:289560 24/107 (22%)
ANK repeat 316..342 CDD:293786 9/37 (24%)
ANK 339..493 CDD:238125 37/178 (21%)
ANK repeat 344..376 CDD:293786 9/31 (29%)
ANK repeat 378..409 CDD:293786 4/30 (13%)
Ank_2 383..504 CDD:289560 28/142 (20%)
ANK 468..594 CDD:238125 26/99 (26%)
ANK repeat 473..504 CDD:293786 10/38 (26%)
Ank_2 479..571 CDD:289560 23/84 (27%)
ANK repeat 506..538 CDD:293786 6/31 (19%)
ANK 536..659 CDD:238125 7/19 (37%)
ANK repeat 540..571 CDD:293786 5/15 (33%)
Ank_2 545..636 CDD:289560 4/10 (40%)
ANK repeat 573..601 CDD:293786
ANK repeat 605..636 CDD:293786
Ion_trans 857..1080 CDD:278921
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2336
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.