DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sowah and LOC100331692

DIOPT Version :9

Sequence 1:NP_001137943.2 Gene:sowah / 39438 FlyBaseID:FBgn0036302 Length:780 Species:Drosophila melanogaster
Sequence 2:XP_009295347.1 Gene:LOC100331692 / 100331692 -ID:- Length:378 Species:Danio rerio


Alignment Length:416 Identity:108/416 - (25%)
Similarity:166/416 - (39%) Gaps:110/416 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ELSVAEIRNYMLANECKVTNHALVKHFKKFLTHPQSQNEA--RKRFKTYVTLLSTIKNENNQKFL 68
            |:|.|.:.:|:.::..||.|..|.|.:|.|:.|...|..|  |:.||..:..::.:|:||.:|:|
Zfish     3 EISEASLLDYIRSSGGKVKNSDLSKTYKHFINHSDLQLRAKYREEFKLIIDRIAVVKSENGEKYL 67

  Fly    69 ILRKKYVNECPTDEVVERAVAAASGIPEPSSPGGASLNFDSPMRQPPPYKPPP----MVTSPPAV 129
            ||:|||..|            ..||    :..||.|:.         |..|.|    :|::|   
Zfish    68 ILKKKYRQE------------QVSG----TKKGGESIK---------PLHPNPQNELLVSNP--- 104

  Fly   130 SIAKEHQENYQECVDEFTAAIKRIEPARLERRTSVKSEDLDQQEKPEKTSRSNSIDVIDNKENIP 194
                  .:|..:       |.|..:|..:...:.......|.||                     
Zfish   105 ------MQNRSQ-------AAKTPQPVMVAWCSGPMITVTDAQE--------------------- 135

  Fly   195 RFSFSSEASSASSTSIEKPEMADPTAPAAVGDVAENPISVKEATRKFNRMASEEEAKIISPPAKK 259
                                      |..:.|..|..:|:| |..:...::|.:..:.:...:..
Zfish   136 --------------------------PTDIDDQTEGALSLK-AEHQSEEISSSDREEDLDKDSGS 173

  Fly   260 KPEKQLIEEK----DSPEVTLAHPKAKEWIVSMAKANYQELAKMASEYPELVKLQ--CPATGYTA 318
            |.|.:..||.    .|..|.| .|..||||.|.|......|.::..:...|...:  |.   ::|
Zfish   174 KSESEQDEESGGSLGSTSVAL-DPLEKEWIFSAASGKLCHLTQLLKQDSSLANKKDFCE---FSA 234

  Fly   319 LHWAAKHGNEDVVKLI--AGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKANRDIMDW 381
            ||||||||.||:...:  ||   ||:|.:.:|||||||:|...|..:|.:||...|.|..::.|:
Zfish   235 LHWAAKHGKEDMTTALVEAG---ADINTKAHGGYTPLHIAALHGHRHIVDLLVRTYGAKENLRDY 296

  Fly   382 SGNKPLDYSRQRSSVSASTCSSEYAK 407
            ||..|..|...|.:.|.....||.::
Zfish   297 SGRLPYYYLNLRDTHSEEHDLSEVSE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sowahNP_001137943.2 Ank_4 289..333 CDD:290365 15/45 (33%)
ANK <315..393 CDD:238125 35/79 (44%)
Ank_4 315..368 CDD:290365 26/54 (48%)
ANK repeat 315..346 CDD:293786 16/32 (50%)
ANK repeat 348..380 CDD:293786 14/31 (45%)
LOC100331692XP_009295347.1 Ank_2 202..295 CDD:289560 36/98 (37%)
ANK 225..>304 CDD:238125 35/84 (42%)
ANK repeat 230..261 CDD:293786 17/36 (47%)
ANK repeat 263..295 CDD:293786 14/31 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1531345at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.