DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4069 and AT1G18610

DIOPT Version :10

Sequence 1:NP_648590.1 Gene:CG4069 / 39437 FlyBaseID:FBgn0036301 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_173296.3 Gene:AT1G18610 / 838442 AraportID:AT1G18610 Length:556 Species:Arabidopsis thaliana


Alignment Length:256 Identity:73/256 - (28%)
Similarity:111/256 - (43%) Gaps:49/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PPTPRSNFTLVCHPEKEELIMFGGELYTGTKTTVYN---DLFFYNTKTVEWRQLKSPS----GPT 122
            ||.||.:.:  |....:.|.:|||       |...|   ||:..:|.:..|   |.||    ||.
plant    74 PPPPRDSHS--CTTVGDNLFVFGG-------TDGVNPLKDLYILDTSSHTW---KCPSVRGEGPE 126

  Fly   123 PRSGHQMVAVASNGGELWMFGGEHASPSQLQFHHYKDLWKFALKSRKWER-IAAPNGPSPRSGHR 186
            .|.||....|   |..|::|||...|....:..:|.|::.|..::..|:| :...|.||.|..|.
plant   127 AREGHSATLV---GKRLFVFGGCGKSSGINEEIYYNDVYIFNTETFVWKRAVTIGNPPSARDSHS 188

  Fly   187 MTVSKKRLFIFGG--FHDNNQSYHYFNDVHIFSLESYQWLKAEIGGAIVPSPRSGCCIAASPEGK 249
            .:..|.:|.:.||  .||     :|.:||||...::..|.:....|.:: :||:| .:..|....
plant   189 CSSWKNKLVVIGGEDGHD-----YYLSDVHILDTDTLIWKELNTSGQLL-TPRAG-HVTVSLGRN 246

  Fly   250 IYVWGGYSRAAMKKEADRGVTHTDMFVLSQDKNAGDADNKYKWAPVKPGGYKPKPR-SSVG 309
            .:|:||::        |....:.|::||..|...        |:.|...|..|..| ||.|
plant   247 FFVFGGFT--------DAQNLYDDLYVLDVDTCI--------WSKVLTMGEGPSARFSSAG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4069NP_648590.1 NanM 64..353 CDD:442289 73/256 (29%)
KELCH repeat 69..120 CDD:276965 15/57 (26%)
KELCH repeat 124..179 CDD:276965 16/55 (29%)
KELCH repeat 305..353 CDD:276965 4/6 (67%)
Kelch_5 423..463 CDD:433528
KELCH repeat 426..470 CDD:276965
AT1G18610NP_173296.3 NanM 22..311 CDD:442289 73/256 (29%)
KELCH repeat 25..69 CDD:276965
KELCH repeat 78..125 CDD:276965 15/58 (26%)
KELCH repeat 128..173 CDD:276965 14/47 (30%)
KELCH repeat 184..232 CDD:276965 15/52 (29%)
KELCH repeat 235..281 CDD:276965 13/62 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.