DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4069 and LKP2

DIOPT Version :10

Sequence 1:NP_648590.1 Gene:CG4069 / 39437 FlyBaseID:FBgn0036301 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_849983.1 Gene:LKP2 / 816408 AraportID:AT2G18915 Length:611 Species:Arabidopsis thaliana


Alignment Length:304 Identity:80/304 - (26%)
Similarity:122/304 - (40%) Gaps:45/304 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VCPPPTPRSNFTLVCHPEKEELIMFGGELYTGTKTTVYNDLFF--YNTKTVEWRQLKSPSGPTPR 124
            |..||..|...||.| .....|::|||....|    :.||:|.  .:.....||::...:.|.||
plant   339 VSSPPPGRWGHTLSC-VNGSRLVVFGGYGSHG----LLNDVFLLDLDADPPSWREVSGLAPPIPR 398

  Fly   125 SGHQMVAVASNGGELWMFGGEHASPSQLQFHHYKDLWKFALKSRKWERIAAPNGPSPRSGHRMTV 189
            |.|....:  :|.:|.:.||...|.:.|......||   ::....|..|..|..|..|.||.:||
plant   399 SWHSSCTL--DGTKLIVSGGCADSGALLSDTFLLDL---SMDIPAWREIPVPWTPPSRLGHTLTV 458

  Fly   190 -SKKRLFIFGGFHDNNQSYHYFNDVHIFSL--ESYQWL------KAEIGGAIVPSPRSGCCIAAS 245
             ..:::.:|||...|.......|||:...|  :...|.      .:..||...|.||......:.
plant   459 YGDRKILMFGGLAKNGTLRFRSNDVYTMDLSEDEPSWRPVIGYGSSLPGGMAAPPPRLDHVAISL 523

  Fly   246 PEGKIYVWGGYSRAAMKKEADRGVTHTDMFVLSQDKNAGDADNKYKWAPVK-PGGYKPKPRSSVG 309
            |.|:|.::|| |.|.:.       :.:.:::|  |.|    :.|..|..:. .||   .||.:.|
plant   524 PGGRILIFGG-SVAGLD-------SASQLYLL--DPN----EEKPAWRILNVQGG---PPRFAWG 571

  Fly   310 CTVAANG--KAYTFGGVMDVDEDDEDVHGQFGDDLLAFDLTSQT 351
            .|....|  :....||    ...:|.:..:..:.|||...|:.|
plant   572 HTTCVVGGTRLVVLGG----QTGEEWMLNEAHELLLATSTTAST 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4069NP_648590.1 NanM 64..353 CDD:442289 79/302 (26%)
KELCH repeat 69..120 CDD:276965 14/52 (27%)
KELCH repeat 124..179 CDD:276965 14/54 (26%)
KELCH repeat 305..353 CDD:276965 12/49 (24%)
Kelch_5 423..463 CDD:433528
KELCH repeat 426..470 CDD:276965
LKP2NP_849983.1 PRK13558 <43..>151 CDD:237426
F-box_AtADO-like 197..243 CDD:438925
NanM 294..589 CDD:442289 74/280 (26%)
KELCH repeat 294..342 CDD:276965 1/2 (50%)
KELCH repeat 346..395 CDD:276965 14/53 (26%)
KELCH repeat 398..443 CDD:276965 12/49 (24%)
KELCH repeat 451..498 CDD:276965 14/46 (30%)
KELCH repeat 515..560 CDD:276965 13/58 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.