Sequence 1: | NP_648590.1 | Gene: | CG4069 / 39437 | FlyBaseID: | FBgn0036301 | Length: | 509 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157201.2 | Gene: | Klhdc3 / 71765 | MGIID: | 2651568 | Length: | 382 | Species: | Mus musculus |
Alignment Length: | 318 | Identity: | 73/318 - (22%) |
---|---|---|---|
Similarity: | 116/318 - (36%) | Gaps: | 81/318 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 LYTGTKTT--VYNDLFFYNTKTVEWRQLKSP--SGPTP--RSGHQMVAVASNGGELWMFGGEHAS 148
Fly 149 PSQLQFHHYKDLWKFALKSRKWERIAAPNGPSP-RSGHRMTVSKKRLFIFGG-------FHDNNQ 205
Fly 206 SYHYFNDVHIFSLESYQWLKAEIGGAIVPSPRSGCCIAASPEGKIYVWGGYSRAAMKKEADRGVT 270
Fly 271 HTDMFVLSQDKNAGDADNKYKWAPVKPGGYKPKPRSSVGCTVAANGKAYTFGGVMDVDE------ 329
Fly 330 ----DDEDVHGQFGDDLLAFDLTSQT---------------------WRLQEIQTKSS 362 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4069 | NP_648590.1 | KELCH repeat | 69..120 | CDD:276965 | 8/33 (24%) |
Kelch_3 | 80..132 | CDD:290151 | 14/47 (30%) | ||
KELCH repeat | 124..179 | CDD:276965 | 12/54 (22%) | ||
Kelch_3 | 136..189 | CDD:290151 | 12/53 (23%) | ||
Kelch_3 | 191..244 | CDD:290151 | 14/59 (24%) | ||
Kelch_2 | 237..297 | CDD:284956 | 13/59 (22%) | ||
KELCH repeat | 305..353 | CDD:276965 | 13/78 (17%) | ||
Kelch_5 | 423..463 | CDD:290565 | |||
KELCH repeat | 426..470 | CDD:276965 | |||
Klhdc3 | NP_001157201.2 | KELCH repeat | 180..236 | CDD:276965 | 15/57 (26%) |
Kelch 4 | 191..249 | 15/61 (25%) | |||
KELCH repeat | 239..283 | CDD:276965 | 13/60 (22%) | ||
Kelch 5 | 251..301 | 15/64 (23%) | |||
KELCH repeat | 14..62 | CDD:276965 | |||
Kelch_6 | 14..61 | CDD:372847 | |||
Kelch 1 | 25..77 | ||||
PLN02153 | 74..>318 | CDD:177814 | 63/256 (25%) | ||
KELCH repeat | 77..124 | CDD:276965 | 10/35 (29%) | ||
Kelch 2 | 88..138 | 14/52 (27%) | |||
KELCH repeat | 128..173 | CDD:276965 | 12/51 (24%) | ||
Kelch 3 | 139..189 | 12/53 (23%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1494 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |