DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4069 and FBXO42

DIOPT Version :9

Sequence 1:NP_648590.1 Gene:CG4069 / 39437 FlyBaseID:FBgn0036301 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_061867.1 Gene:FBXO42 / 54455 HGNCID:29249 Length:717 Species:Homo sapiens


Alignment Length:431 Identity:99/431 - (22%)
Similarity:162/431 - (37%) Gaps:90/431 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KEGKIEAISESVCPPPTP---RSNFTLVCHPEKEELIMFGGELYTGTKTTVYNDLFFYNTKTVEW 112
            :||.|:..|.:...|.||   |.:.:...:...:.:.:||| ....:....:|||:..:..:.||
Human    98 QEGNIQWESRTYPYPGTPITQRFSHSACYYDANQSMYVFGG-CTQSSCNAAFNDLWRLDLNSKEW 161

  Fly   113 -RQLKSPSGPTPRSGHQMVAVASNGGELWMFGGEHASPSQLQFHH----YKDLWKFALKSRKWER 172
             |.|.|.|.|:|::|..:|....   .|.:||| ...||....|.    :.::..::.....|..
Human   162 IRPLASGSYPSPKAGATLVVYKD---LLVLFGG-WTRPSPYPLHQPERFFDEIHTYSPSKNWWNC 222

  Fly   173 IAAPNGPSPRSGHRMTVSKKRLFIFGGFHDNNQSYHYFNDVHIFSLESYQWLKAEIGGAIVPSPR 237
            |...:||.|.:||...|...::.:|||...:.|   ..|||.:..||.:.|.|..|.|. .|.||
Human   223 IVTTHGPPPMAGHSSCVIDDKMIVFGGSLGSRQ---MSNDVWVLDLEQWAWSKPNISGP-SPHPR 283

  Fly   238 SGCCIAASPEGKIYVWGGYSRA-AMKKEADRGVTHT------DMFVLSQDKNAGDADNKYKW--- 292
            .|.......:..|.:.||.... |:.|:|.....|:      .:.|.:::..|.:.     |   
Human   284 GGQSQIVIDDATILILGGCGGPNALFKDAWLLHMHSGPWAWQPLKVENEEHGAPEL-----WCHP 343

  Fly   293 ------------------APVKPG-GYKPKPRSSVGCTVAANGKAYTFGGVMDVDEDDEDVHGQF 338
                              ||:.|. ..:|.|.|:....:....:.|.....:...::...|:|::
Human   344 ACRVGQCVVVFSQAPSGRAPLSPSLNSRPSPISATPPALVPETREYRSQSPVRSMDEAPCVNGRW 408

  Fly   339 GDDLLAFDLTSQTWRLQEIQTKSSSAEKKDSEESKD----------------VEMSAVDKPVTTT 387
            |      .|..:..|    ||.|.|.|...|....|                |..|::|.||...
Human   409 G------TLRPRAQR----QTPSGSREGSLSPARGDGSPILNGGSLSPGTAAVGGSSLDSPVQAI 463

  Fly   388 TDGIFTVTVGGPSTSTTP--FVSKIPSLFAKPKPTNVPSPR 426
            :          |||.:.|  :..|| .|...|:..::|..:
Human   464 S----------PSTPSAPEGYDLKI-GLSLAPRRGSLPDQK 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4069NP_648590.1 KELCH repeat 69..120 CDD:276965 12/51 (24%)
Kelch_3 80..132 CDD:290151 16/52 (31%)
KELCH repeat 124..179 CDD:276965 11/58 (19%)
Kelch_3 136..189 CDD:290151 14/56 (25%)
Kelch_3 191..244 CDD:290151 17/52 (33%)
Kelch_2 237..297 CDD:284956 14/87 (16%)
KELCH repeat 305..353 CDD:276965 6/47 (13%)
Kelch_5 423..463 CDD:290565 1/4 (25%)
KELCH repeat 426..470 CDD:276965 0/1 (0%)
FBXO42NP_061867.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
F-box-like 47..>82 CDD:315592
KELCH repeat 119..168 CDD:276965 11/49 (22%)
Kelch_3 130..182 CDD:315978 16/52 (31%)
Kelch 1 132..184 16/52 (31%)
KELCH repeat 174..229 CDD:276965 11/58 (19%)
Kelch_3 183..240 CDD:315978 14/60 (23%)
Kelch 2 186..242 15/56 (27%)
Guanylate_kin 228..>360 CDD:331880 33/140 (24%)
Kelch_5 229..268 CDD:316377 14/41 (34%)
KELCH repeat 232..271 CDD:276965 12/41 (29%)
Kelch 3 244..293 17/52 (33%)
Kelch 4 295..342 10/51 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..474 28/132 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 570..631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1494
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.