DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4069 and Hcf

DIOPT Version :9

Sequence 1:NP_648590.1 Gene:CG4069 / 39437 FlyBaseID:FBgn0036301 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_524621.2 Gene:Hcf / 43788 FlyBaseID:FBgn0039904 Length:1500 Species:Drosophila melanogaster


Alignment Length:436 Identity:97/436 - (22%)
Similarity:158/436 - (36%) Gaps:135/436 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PPPTPRSNFTLVCHPEKEELIMFGGELYTGTKTTVYNDLFFYNTKTVEWRQLKSPSGPTPRSGHQ 128
            |.|.||.....:  ..||.:::|||    |.:..| ::|..|||.|.:| .:....|..| :|..
  Fly    69 PQPRPRHGHRAI--NIKELMVVFGG----GNEGIV-DELHVYNTVTNQW-YVPVLKGDVP-NGCA 124

  Fly   129 MVAVASNGGELWMFGGEHASPSQLQFHHY-KDLWKFALKSRKWE-RIAAPNGPS------PRSGH 185
            .......|..:::|||      .:::..| .:|::  |::.||| |...|..|.      ||.||
  Fly   125 AYGFVVEGTRMFVFGG------MIEYGKYSNELYE--LQATKWEWRKMYPESPDSGLSPCPRLGH 181

  Fly   186 RMTVSKKRLFIFGGFHD-----NNQSYHYFNDVHIFSLESY-----QWLKAEIGGAIVPSPR--- 237
            ..|:..:::|:|||..:     .|....|.||::|......     :|:..:..|. .|.||   
  Fly   182 SFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGD-SPPPRESH 245

  Fly   238 SGCCIAASPEG--KIYVWGGYSRAAMKKEADRGVTHTDMFVLSQDKNAGDADNKYKWAPVKPGGY 300
            :|...|....|  .:.::||.|          |....|:::|..|        ...|:..|..|.
  Fly   246 TGISFATKSNGNLNLLIYGGMS----------GCRLGDLWLLETD--------SMTWSKPKTSGE 292

  Fly   301 KPKPRSSVGCTVAANGKAYTFGG----VMDVDEDDEDVHGQFGDDLLAFDLTSQTWRLQEIQTKS 361
            .|.|||....|:..| |.|.|||    |::..:...:...:..:.|...||.:.||         
  Fly   293 APLPRSLHSSTMIGN-KMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMTW--------- 347

  Fly   362 SSAEKKDSEESKDVEMSAVDKPVTTTTDGIFTVTVGGPSTSTTPFVSKIPSLFAKPKPTNVPSPR 426
                       ::|.:..|::.|                                        ||
  Fly   348 -----------ENVTLDTVEENV----------------------------------------PR 361

  Fly   427 MNPGMCV--CKGTLYIFGGIFEED------DKQLTYNDFYALDLHK 464
            ...|.|.  .:..||::.|   .|      :.|:...|.:.|::.|
  Fly   362 ARAGHCAVGIQSRLYVWSG---RDGYRKAWNNQVCCKDLWYLEVSK 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4069NP_648590.1 KELCH repeat 69..120 CDD:276965 14/50 (28%)
Kelch_3 80..132 CDD:290151 16/51 (31%)
KELCH repeat 124..179 CDD:276965 13/56 (23%)
Kelch_3 136..189 CDD:290151 17/60 (28%)
Kelch_3 191..244 CDD:290151 15/65 (23%)
Kelch_2 237..297 CDD:284956 12/64 (19%)
KELCH repeat 305..353 CDD:276965 14/51 (27%)
Kelch_5 423..463 CDD:290565 11/47 (23%)
KELCH repeat 426..470 CDD:276965 11/47 (23%)
HcfNP_524621.2 Kelch_1 73..110 CDD:279660 14/43 (33%)
KELCH repeat 74..115 CDD:276965 14/48 (29%)
KELCH repeat 123..175 CDD:276965 13/59 (22%)
Kelch_3 132..184 CDD:290151 17/59 (29%)
Kelch_5 175..221 CDD:290565 14/45 (31%)
KELCH repeat 178..239 CDD:276965 15/61 (25%)
Kelch_3 260..305 CDD:290151 15/62 (24%)
KELCH repeat 297..360 CDD:276965 18/123 (15%)
Kelch_3 306..371 CDD:290151 19/125 (15%)
FN3 <1307..1338 CDD:238020
FN3 1344..1448 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446739
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1494
SonicParanoid 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.