DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4069 and slim

DIOPT Version :9

Sequence 1:NP_648590.1 Gene:CG4069 / 39437 FlyBaseID:FBgn0036301 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_523782.1 Gene:slim / 37121 FlyBaseID:FBgn0261477 Length:609 Species:Drosophila melanogaster


Alignment Length:467 Identity:82/467 - (17%)
Similarity:131/467 - (28%) Gaps:214/467 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 EWRQLKSPSG-PTPRSGHQMVAVASNGGELWMFGGEHASPSQLQFHH-----YKDLWKFALKSRK 169
            ::|....|.| |..||||:::|   :...|:..||.:...:.....|     :::||.:...:|.
  Fly   189 QYRDKHIPGGFPLARSGHRIIA---SNSHLYSLGGYNPRSAMSASRHGRCLLFQELWSYNFATRT 250

  Fly   170 WE------------------------------------------------RIAAPNG-------- 178
            |.                                                |.|:...        
  Fly   251 WRLELNAGNAANMPVELASNALTIHNNVLISHGGTGYPFGVSCSNDCYVYRTASAGATPGVDRLQ 315

  Fly   179 -----PSPRSGHRMTVSKKRLFIFGGFHDNNQSYHYFNDVHIFSLESYQWLKAEIGGAIVPSPRS 238
                 |:.:.|..:.:.|..|:..||    ...:.|..||:...|.:..|....|..   |..|.
  Fly   316 VKGDLPTAQYGPGIVIHKHFLYTIGG----TTGFDYTCDVYRLDLRTGIWENVYISR---PEMRD 373

  Fly   239 GCCIAASPEGK-----------IYVWGGYSRAAMKKEADRGVTHT-----------------DMF 275
                  .|||:           |:|.||            |.:|:                 |.|
  Fly   374 ------DPEGRYRHEVVYDGKHIFVLGG------------GTSHSVYDLQRIPAYNLEANCWDYF 420

  Fly   276 VLSQDKNAGDADNKYKWAPVKPGGYKPKPRSSVGCT--VAANG--KAYTFGGVMDVDEDDEDVHG 336
            ....|:.|.|||:..:       || ||||....|.  .::.|  :|:..||          :.|
  Fly   421 ETYPDQRAADADDGNR-------GY-PKPRKCFSCVQHQSSTGDIEAFITGG----------LQG 467

  Fly   337 QFG---DDLLAFDLTSQTWRLQEIQTKSSSAEKKDSEESKDVEMSAVDKPVTTTTDGIFTVTVGG 398
            .|.   .|:...:|.::.|  ..|:|.                                      
  Fly   468 DFSTYFSDIWKLNLRTKHW--YRIETA-------------------------------------- 492

  Fly   399 PSTSTTPFVSKIPSLFAKPKPTNVPSPRMNPGMCVCKGTLYIFGGIFEEDDKQLTYNDFYAL--- 460
                            ..|:|....|...:...|     :|:||||...|.:....||.|.:   
  Fly   493 ----------------ILPRPLYFHSAAHSDNGC-----MYVFGGIEYIDKEMRRRNDLYKMWMT 536

  Fly   461 --DLHKLEWKVL 470
              .|.::.|..:
  Fly   537 VPKLSEMCWDAI 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4069NP_648590.1 KELCH repeat 69..120 CDD:276965 2/8 (25%)
Kelch_3 80..132 CDD:290151 8/21 (38%)
KELCH repeat 124..179 CDD:276965 15/120 (13%)
Kelch_3 136..189 CDD:290151 12/118 (10%)
Kelch_3 191..244 CDD:290151 12/52 (23%)
Kelch_2 237..297 CDD:284956 17/87 (20%)
KELCH repeat 305..353 CDD:276965 10/54 (19%)
Kelch_5 423..463 CDD:290565 11/44 (25%)
KELCH repeat 426..470 CDD:276965 12/48 (25%)
slimNP_523782.1 KELCH repeat 203..263 CDD:276965 13/62 (21%)
KELCH repeat 267..321 CDD:276965 2/53 (4%)
KELCH repeat 324..364 CDD:276965 10/43 (23%)
Kelch_1 325..372 CDD:279660 12/53 (23%)
Kelch_4 441..492 CDD:290154 13/62 (21%)
KELCH repeat 442..495 CDD:276965 13/118 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.