DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4069 and HCFC2

DIOPT Version :10

Sequence 1:NP_648590.1 Gene:CG4069 / 39437 FlyBaseID:FBgn0036301 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_037452.1 Gene:HCFC2 / 29915 HGNCID:24972 Length:792 Species:Homo sapiens


Alignment Length:511 Identity:106/511 - (20%)
Similarity:176/511 - (34%) Gaps:168/511 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PTPRSNFTLVCHPEKEELIMFGGELYTGTKTTVYNDLFFYNTKTVEWRQLKSPSGPTPR--SGHQ 128
            |.||:.........:|.:|:|||    |.: .:.::|..|||.|.:| .|.:..|..|.  :.|.
Human    18 PVPRARHGHRAVAIRELMIIFGG----GNE-GIADELHVYNTATNQW-FLPAVRGDIPPGCAAHG 76

  Fly   129 MVAVASNGGELWMFGGEHASPSQLQFHHY-KDLWKFALKSRKWERI---AAPNG--PSPRSGHRM 187
            .|.   :|..:.:|||      .:::..| .:|::.......|:::   ..|:|  |.||.||..
Human    77 FVC---DGTRILVFGG------MVEYGRYSNELYELQASRWLWKKVKPHPPPSGLPPCPRLGHSF 132

  Fly   188 TVSKKRLFIFGGF-----HDNNQSYHYFNDVHIFSLES----YQWLKAEIGGAIVPSPRSG---- 239
            ::...:.::|||.     ..||....|.||.:...|:.    ..| ...:...:|||||..    
Human   133 SLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGW-SIPVTKGVVPSPRESHTAV 196

  Fly   240 -CCIAASPEGKIYVWGGYSRAAMKKEADRGVTHTDMFVLSQDKNAGDADNKYKWAPVKPGGYKPK 303
             .|...|...|:||:||...|.:          .|::.|..:        ...|:..:..|..|.
Human   197 IYCKKDSGSPKMYVFGGMCGARL----------DDLWQLDLE--------TMSWSKPETKGTVPL 243

  Fly   304 PRSSVGCTVAANGKAYTFGGVM-----DVDEDDEDVHGQFGDDLLAFDLTSQTWRLQEIQTKSSS 363
            |||....:|..| |.|.|||.:     :.:....|...:........:|.:..|      |...|
Human   244 PRSLHTASVIGN-KMYIFGGWVPHKGENTETSPHDCEWRCTSSFSYLNLDTTEW------TTLVS 301

  Fly   364 AEKKDSEESKDVEMSAVDKPVTTTTDGIFTVTVGGPSTSTTPFVSKIPSLFAKPKPTNVPSPRMN 428
            ..::|.:.|:                                                   ||..
Human   302 DSQEDKKNSR---------------------------------------------------PRPR 315

  Fly   429 PGMC-VCKGT-LYIFGGIFEED------DKQLTYNDFYALDLHK------------------LEW 467
            .|.| |..|| ||.:.|   .|      :.|:...|.:.||..|                  ::|
Human   316 AGHCAVAIGTRLYFWSG---RDGYKKALNSQVCCKDLWYLDTEKPPAPSQVQLIKATTNSFHVKW 377

  Fly   468 KVLIPNSLKG----------HEWEDSDSSSS--------DEECSGSEEDISSSSSD 505
            ..:  ::::|          ::...||||::        |....||...:.:|.:|
Human   378 DEV--STVEGYLLQLSTDLPYQAASSDSSAAPNMQGVRMDPHRQGSNNIVPNSIND 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4069NP_648590.1 NanM 64..353 CDD:442289 74/313 (24%)
KELCH repeat 69..120 CDD:276965 14/50 (28%)
KELCH repeat 124..179 CDD:276965 11/62 (18%)
KELCH repeat 305..353 CDD:276965 11/52 (21%)
Kelch_5 423..463 CDD:433528 15/47 (32%)
KELCH repeat 426..470 CDD:276965 16/69 (23%)
HCFC2NP_037452.1 NanM 14..332 CDD:442289 88/405 (22%)
KELCH repeat 23..69 CDD:276965 14/51 (27%)
Kelch 1 34..79 15/50 (30%)
Kelch 2 83..130 11/52 (21%)
KELCH repeat 127..186 CDD:276965 13/59 (22%)
KELCH repeat 190..241 CDD:276965 13/68 (19%)
Kelch 3 207..255 15/65 (23%)
KELCH repeat 245..312 CDD:276965 16/124 (13%)
Kelch 4 257..303 9/51 (18%)
Kelch_5 312..355 CDD:433528 15/45 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..447 9/33 (27%)
FN3 535..>704 CDD:442628
FN3 <618..672 CDD:238020
FN3 678..778 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.