DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4069 and Hcfc1

DIOPT Version :9

Sequence 1:NP_648590.1 Gene:CG4069 / 39437 FlyBaseID:FBgn0036301 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_006527898.1 Gene:Hcfc1 / 15161 MGIID:105942 Length:2090 Species:Mus musculus


Alignment Length:491 Identity:106/491 - (21%)
Similarity:173/491 - (35%) Gaps:145/491 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 MLEKLGEANIADIIQLLEAKEGKIEAISESVCPPPTPRSNFTLVCHPEKEELIMFGGELYTGTKT 96
            |...:..||:..:  ||:.:..::...|.   |.|.||.....|.  .||.:::|||    |.:.
Mouse     1 MASAVSPANLPAV--LLQPRWKRVVGWSG---PVPRPRHGHRAVA--IKELIVVFGG----GNEG 54

  Fly    97 TVYNDLFFYNTKTVEWRQLKSPSGPTPRSGHQMVAVASNGGELWMFGGEHASPSQLQFHHY-KDL 160
            .| ::|..|||.|.:| .:.:..|..| .|........:|..|.:|||      .:::..| .||
Mouse    55 IV-DELHVYNTATNQW-FIPAVRGDIP-PGCAAYGFVCDGTRLLVFGG------MVEYGKYSNDL 110

  Fly   161 WKFALKSRKWERIAA---PNG--PSPRSGHRMTVSKKRLFIFGGFHDN-----NQSYHYFNDVHI 215
            ::......:|:|:.|   .||  |.||.||..::...:.::|||..::     |....|.||::|
Mouse   111 YELQASRWEWKRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYI 175

  Fly   216 FSLESYQWLKA---EIGGAIVPSPRSGCCIAASPE-----GKIYVWGGYSRAAMKKEADRGVTHT 272
            ..|.....:.|   .|...::|.||.........|     .|:.::||.|          |....
Mouse   176 LELRPGSGVVAWDIPITYGVLPPPRESHTAVVYTEKDNKKSKLVIYGGMS----------GCRLG 230

  Fly   273 DMFVLSQDKNAGDADNKYKWAPVKPGGYKPKPRSSVGCTVAANGKAYTFGGVMDVDEDDEDV--- 334
            |::.|..:        ...|......|..|.|||....|...| |.|.|||.:.:..||..|   
Mouse   231 DLWTLDIE--------TLTWNKPSLSGVAPLPRSLHSATTIGN-KMYVFGGWVPLVMDDVKVATH 286

  Fly   335 --HGQFGDDLLAFDLTSQTW--------------------------------------------- 352
              ..:..:.|...:|.:..|                                             
Mouse   287 EKEWKCTNTLACLNLDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQV 351

  Fly   353 -----------------RLQEIQTKSSSAEKK----DSEESKDVEMSAVDKPVTTTTDGIFTVTV 396
                             |:|.::..::|.|..    .:.:|..:::...|.|.|..|        
Mouse   352 CCKDLWYLETEKPPPPARVQLVRANTNSLEVSWGAVATADSYLLQLQKYDIPATAAT-------- 408

  Fly   397 GGPSTSTTPFVSKIPSLFAKPKPTNVP---SPRMNP 429
               :||.||  :.:||:.|.|..:..|   :|.:.|
Mouse   409 ---ATSPTP--NPVPSVPANPPKSPAPAAAAPAVQP 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4069NP_648590.1 KELCH repeat 69..120 CDD:276965 15/50 (30%)
Kelch_3 80..132 CDD:290151 16/51 (31%)
KELCH repeat 124..179 CDD:276965 14/60 (23%)
Kelch_3 136..189 CDD:290151 18/58 (31%)
Kelch_3 191..244 CDD:290151 14/60 (23%)
Kelch_2 237..297 CDD:284956 10/64 (16%)
KELCH repeat 305..353 CDD:276965 15/114 (13%)
Kelch_5 423..463 CDD:290565 3/10 (30%)
KELCH repeat 426..470 CDD:276965 1/4 (25%)
Hcfc1XP_006527898.1 PLN02193 <27..322 CDD:177844 80/331 (24%)
KELCH repeat 33..80 CDD:276965 17/55 (31%)
KELCH repeat 84..134 CDD:276965 13/55 (24%)
KELCH repeat 137..196 CDD:276965 14/58 (24%)
KELCH repeat 200..253 CDD:276965 11/70 (16%)
KELCH repeat 255..319 CDD:276965 15/64 (23%)
Kelch_5 319..>351 CDD:372758 0/31 (0%)
KELCH repeat 322..367 CDD:276965 0/44 (0%)
Herpes_BLLF1 <441..771 CDD:282904
FN3 <1911..1940 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1494
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.