DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4069 and KLHDC1

DIOPT Version :10

Sequence 1:NP_648590.1 Gene:CG4069 / 39437 FlyBaseID:FBgn0036301 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_751943.1 Gene:KLHDC1 / 122773 HGNCID:19836 Length:406 Species:Homo sapiens


Alignment Length:338 Identity:79/338 - (23%)
Similarity:117/338 - (34%) Gaps:101/338 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 RSGHRMTVSKKRLFIFGGF--HDNNQSYHYFNDVHIFSLESYQWLKAEIGGAIVPSPRSGCCIAA 244
            ||||...|....|:::||:  .::|:.|...:::..:.::|..|....:.|.: |:..||.| .|
Human    13 RSGHCAVVDGNFLYVWGGYVSIEDNEVYLPNDEIWTYDIDSGLWRMHLMEGEL-PASMSGSC-GA 75

  Fly   245 SPEGKIYVWGGYSRAAMKKEADRGVTHTDMFVLSQDKNAGDADNKYKWAPVKP-GGYKPKPRSSV 308
            ...||:|::|||.        |:|.::...||     |....|..|.|..:.. .|..|.||..:
Human    76 CINGKLYIFGGYD--------DKGYSNRLYFV-----NLRTRDETYIWEKITDFEGQPPTPRDKL 127

  Fly   309 GCTVAANGKAYTFGG-----------VMDVDED--DEDVHGQFGDDLLAFDLTSQTWRLQEIQTK 360
            .|.|..:...| |||           ..||.:.  :|.:...:.:|:..||..:|||...||:  
Human   128 SCWVYKDRLIY-FGGYGCRRHSELQDCFDVHDASWEEQIFWGWHNDVHIFDTKTQTWFQPEIK-- 189

  Fly   361 SSSAEKKDSEESKDVEMSAVDKPVTTTTDGIFTVTVGGPSTSTTPFVSKIPSLFAKPKPTNVPSP 425
                                                ||           :|           |.|
Human   190 ------------------------------------GG-----------VP-----------PQP 196

  Fly   426 RMNPGMCVCKGTLYIFGGIFEEDDKQLTYNDFYALDLHKLEWKVLIP---NSLKGHEWEDSDSSS 487
            |......|.....|||||..    .|...||.:.|:|....|...|.   .|.|...|......:
Human   197 RAAHTCAVLGNKGYIFGGRV----LQTRMNDLHYLNLDTWTWSGRITINGESPKHRSWHTLTPIA 257

  Fly   488 SDE--ECSGSEED 498
            .|:  .|.|...|
Human   258 DDKLFLCGGLSAD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4069NP_648590.1 NanM 64..353 CDD:442289 50/186 (27%)
KELCH repeat 69..120 CDD:276965
KELCH repeat 124..179 CDD:276965
KELCH repeat 305..353 CDD:276965 15/60 (25%)
Kelch_5 423..463 CDD:433528 13/39 (33%)
KELCH repeat 426..470 CDD:276965 13/43 (30%)
KLHDC1NP_751943.1 NanM <10..93 CDD:442289 26/89 (29%)
KELCH repeat 13..65 CDD:276965 13/51 (25%)
Kelch 1 24..76 12/53 (23%)
NanM 63..327 CDD:442289 67/288 (23%)
KELCH repeat 69..194 CDD:276965 42/199 (21%)
Kelch 2 80..134 19/66 (29%)
Kelch 3 135..181 10/46 (22%)
KELCH repeat 197..235 CDD:276965 12/41 (29%)
Kelch 4 208..258 15/53 (28%)
KELCH repeat 248..294 CDD:276965 5/23 (22%)
Kelch 5 260..307 3/11 (27%)
Kelch 6 311..361
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.