DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4069 and klhdc2

DIOPT Version :10

Sequence 1:NP_648590.1 Gene:CG4069 / 39437 FlyBaseID:FBgn0036301 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001096337.1 Gene:klhdc2 / 100124923 XenbaseID:XB-GENE-1006177 Length:159 Species:Xenopus tropicalis


Alignment Length:136 Identity:34/136 - (25%)
Similarity:61/136 - (44%) Gaps:20/136 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 PSPRSGHRMTVSKKRLFIFGGFHDN--NQSYHYF---NDVHIFSLESYQWLKAEIGGAIVPSPRS 238
            |:.||||......:.:|::||:.:.  ...|.::   :::.|:.:|:..|.:.:..|.| |...|
 Frog    32 PAERSGHVAVTDGQSIFVWGGYKNAPVRGFYDFYLPRDEIWIYDMENGSWQRVKTKGEI-PLSMS 95

  Fly   239 GCCIAASPEGKIYVWGGYSRAAMKKEADRGVTHTDMFVLSQDKNAGDADNKYKWAPVKPGGYKPK 303
            |.| ||..:..:|::||:....          :|:||.:   .|....|....|..|...|..|.
 Frog    96 GSC-AACVDKVLYLFGGHHAHG----------NTNMFYM---LNLNPRDGDLFWEKVDCKGIPPS 146

  Fly   304 PRSSVG 309
            |:..:|
 Frog   147 PKDKLG 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4069NP_648590.1 NanM 64..353 CDD:442289 34/136 (25%)
KELCH repeat 69..120 CDD:276965
KELCH repeat 124..179 CDD:276965 34/136 (25%)
KELCH repeat 305..353 CDD:276965 1/5 (20%)
Kelch_5 423..463 CDD:433528
KELCH repeat 426..470 CDD:276965
klhdc2NP_001096337.1 NanM <33..>125 CDD:442289 25/106 (24%)
KELCH repeat 35..91 CDD:276965 13/56 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.