DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pmm2 and PMM

DIOPT Version :9

Sequence 1:NP_648589.1 Gene:Pmm2 / 39436 FlyBaseID:FBgn0036300 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_182103.1 Gene:PMM / 819187 AraportID:AT2G45790 Length:246 Species:Arabidopsis thaliana


Alignment Length:240 Identity:136/240 - (56%)
Similarity:177/240 - (73%) Gaps:5/240 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ALKRDEILLLFDVDGTLTMPRSVVTPEFEEFFYSRVKPRATIGIVGGSDLEKMFEQLNGRKILNE 69
            |.|...::.|||||||||.||...|||..:|. ..::...|||:||||||.|:.||| |:.:.|:
plant     2 AAKIPGVIALFDVDGTLTAPRKEATPELLDFI-RELRKVVTIGVVGGSDLSKISEQL-GKTVTND 64

  Fly    70 FDFIFPENGLVQIEGGKEVGKQNIIMHLGEETVKRFINFVLRYLSELDVPIKRGTFIEFRNGMMN 134
            :|:.|.|||||..:.||.:|.|::.:|||::.:|..|||.|.|:::||:||||||||||||||:|
plant    65 YDYCFSENGLVAHKDGKSIGIQSLKLHLGDDKLKELINFTLHYIADLDIPIKRGTFIEFRNGMLN 129

  Fly   135 VCPIGRQCTREERNMFAEYDIEHKVREKMIKDLKQEFADVDLTYSIGGQISFDVFPHGWDKTYCL 199
            |.||||.|::|||:.|..||....:|.||:.:|::.||.::||:||||||||||||.||||||||
plant   130 VSPIGRNCSQEERDEFERYDKVQNIRPKMVAELRERFAHLNLTFSIGGQISFDVFPKGWDKTYCL 194

  Fly   200 RHIEAHYKFKEIHFFGDKTEPGGNDYEIYSDPRTISHRVYTPKDT 244
            :::|   .|.|||||||||..||||||||..|:||.|.|.:|.||
plant   195 QYLE---DFSEIHFFGDKTYEGGNDYEIYESPKTIGHSVTSPDDT 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pmm2NP_648589.1 HAD-SF-IIB 12..234 CDD:273651 127/221 (57%)
PMM 33..254 CDD:281343 120/212 (57%)
PMMNP_182103.1 PLN02423 1..245 CDD:178043 136/240 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 259 1.000 Domainoid score I492
eggNOG 1 0.900 - - E1_COG0561
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H257
Inparanoid 1 1.050 284 1.000 Inparanoid score I862
OMA 1 1.010 - - QHG53697
OrthoDB 1 1.010 - - D1038583at2759
OrthoFinder 1 1.000 - - FOG0002294
OrthoInspector 1 1.000 - - oto4046
orthoMCL 1 0.900 - - OOG6_101634
Panther 1 1.100 - - LDO PTHR10466
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1518
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.