DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pmm2 and PMM1

DIOPT Version :9

Sequence 1:NP_648589.1 Gene:Pmm2 / 39436 FlyBaseID:FBgn0036300 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_011528531.1 Gene:PMM1 / 5372 HGNCID:9114 Length:305 Species:Homo sapiens


Alignment Length:318 Identity:113/318 - (35%)
Similarity:144/318 - (45%) Gaps:98/318 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AALKRDEILLLFDVDGTLTMPRSVVTPE--FEEFFYSRVKP-----RATIGIV------------ 49
            ||.:::.:|.|||||||||..|...:.|  |...|.|...|     |.::..|            
Human     7 AARRKERVLCLFDVDGTLTPARQSWSREGFFSNSFMSSTHPDVRGSRPSLFAVRTLRNSEGPECP 71

  Fly    50 -------------------GGSDLEKMFEQLNGRKILNEFDFIFPENGLVQIEGGKEVGKQNI-- 93
                               |||          ||||                 .|.|..|..:  
Human    72 SPSSVVKLPWLGPWRPSCRGGS----------GRKI-----------------AGLEQRKLTLRW 109

  Fly    94 -------------IMHLGEETVKRFINFV-----LRYL------------SELDVPIKRGTFIEF 128
                         :......||:...::|     ||.|            |..|.....||||||
Human   110 PPSCRSYEVECRSVWWAALTTVRSLSSWVTGMKSLRSLIMCLPRTGRCSISTDDCSPSSGTFIEF 174

  Fly   129 RNGMMNVCPIGRQCTREERNMFAEYDIEHKVREKMIKDLKQEFADVDLTYSIGGQISFDVFPHGW 193
            ||||:|:.||||.||.|||..|:|.|.:.|:|||.::.||.|||...|.:|.||.|||||||.||
Human   175 RNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGW 239

  Fly   194 DKTYCLRHIEAHYKFKEIHFFGDKTEPGGNDYEIYSDPRTISHRVYTPKDTQRILTEI 251
            ||.|||..::.. .|..|||||::|.|||||:||::||||:.|.|.:|:||.:...||
Human   240 DKRYCLDSLDQD-SFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pmm2NP_648589.1 HAD-SF-IIB 12..234 CDD:273651 103/291 (35%)
PMM 33..254 CDD:281343 98/287 (34%)
PMM1XP_011528531.1 HAD_like <169..299 CDD:304363 75/129 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145136
Domainoid 1 1.000 250 1.000 Domainoid score I2117
eggNOG 1 0.900 - - E1_COG0561
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 274 1.000 Inparanoid score I2987
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53697
OrthoDB 1 1.010 - - D1038583at2759
OrthoFinder 1 1.000 - - FOG0002294
OrthoInspector 1 1.000 - - otm41412
orthoMCL 1 0.900 - - OOG6_101634
Panther 1 1.100 - - O PTHR10466
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1518
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.