DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pmm2 and pmm2

DIOPT Version :9

Sequence 1:NP_648589.1 Gene:Pmm2 / 39436 FlyBaseID:FBgn0036300 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001135677.1 Gene:pmm2 / 100216238 XenbaseID:XB-GENE-998969 Length:260 Species:Xenopus tropicalis


Alignment Length:246 Identity:130/246 - (52%)
Similarity:171/246 - (69%) Gaps:3/246 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KRDEILLLFDVDGTLTMPRSVVTPEFEEFFYSRVKPRATIGIVGGSDLEKMFEQL-NGRKILNEF 70
            |..:||.|||||||||..|..|.|..::|. ..::.|..||:|||||..|:.||| .|.:::::|
 Frog     8 KHRDILCLFDVDGTLTPAREKVDPAVDQFL-QELRQRVKIGVVGGSDYSKIAEQLGEGDQVVSKF 71

  Fly    71 DFIFPENGLVQIEGGKEVGKQNIIMHLGEETVKRFINFVLRYLSELDVPIKRGTFIEFRNGMMNV 135
            |:||.|||.||.:.||.:.:|.|..|||||.::..|||.|.|::.|.:|.||||||||||||:|:
 Frog    72 DYIFAENGTVQYKDGKLLARQAIQNHLGEELLQDLINFCLMYIALLKLPKKRGTFIEFRNGMLNI 136

  Fly   136 CPIGRQCTREERNMFAEYDIEHKVREKMIKDLKQEFADVDLTYSIGGQISFDVFPHGWDKTYCLR 200
            .||||.||:|||..|.|.|.:.::|||.:..|::|||...|.::.||.||||:||.||||..||.
 Frog   137 SPIGRSCTQEERIEFNELDKKERIREKFVAALQREFAGKGLRFTRGGMISFDIFPEGWDKRCCLE 201

  Fly   201 HIEAHYKFKEIHFFGDKTEPGGNDYEIYSDPRTISHRVYTPKDTQRILTEI 251
            .:.|. :|..|||||::|.|||||||||||||||.|.|.:|:||.:...|:
 Frog   202 VLAAE-QFSSIHFFGNETTPGGNDYEIYSDPRTIGHTVVSPEDTVKRCQEL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pmm2NP_648589.1 HAD-SF-IIB 12..234 CDD:273651 120/222 (54%)
PMM 33..254 CDD:281343 115/220 (52%)
pmm2NP_001135677.1 HAD_PMM 13..251 CDD:319784 127/239 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 241 1.000 Domainoid score I2205
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 264 1.000 Inparanoid score I2990
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1038583at2759
OrthoFinder 1 1.000 - - FOG0002294
OrthoInspector 1 1.000 - - otm48620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1518
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.