DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsf2 and srprb

DIOPT Version :9

Sequence 1:NP_524044.1 Gene:Tsf2 / 39435 FlyBaseID:FBgn0036299 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001002572.1 Gene:srprb / 436845 ZFINID:ZDB-GENE-040718-311 Length:266 Species:Danio rerio


Alignment Length:195 Identity:45/195 - (23%)
Similarity:77/195 - (39%) Gaps:44/195 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 RNQQDGTNTSILYEKFRIFESKRYGKPNLL---------------FQDSSRALTVIPEDDQSFTK 430
            |.|...|.:|..|:.    :|:|.....|:               ::|.:||: |...|...|.|
Zfish    87 RTQTSITESSATYKS----KSERGNSWTLIDVPGHESLRTQIVEKYKDVARAI-VFVVDSSIFQK 146

  Fly   431 YLGPAINFIYGIRECPV---PAMTLCVTSENELDKCIKMRTALKAHLLKPELICKKMHSHINCMQ 492
            .:.....|:|.|....:   .|.||.|.. |:.|  |.|..:.|       ||.:::...:|.::
Zfish   147 DVRDVAEFLYSILTDSILAKNAPTLVVAC-NKQD--ITMAKSAK-------LIQQQLEKELNTLR 201

  Fly   493 FIEAGKADISVFD---AGDVYTG--GLNYDLVPFMSEVYNLGEPEYYVVAVAKEDDPDTELTYLK 552
            ...:  |.:|..|   .|.||.|  |.:::    .|::.|..|........:|.:|.|.::..|:
Zfish   202 LTRS--AALSSQDGAVGGSVYLGKKGKDFE----FSQLANRVEFIECKARGSKTEDGDADIDALE 260

  Fly   553  552
            Zfish   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsf2NP_524044.1 PBP2_transferrin 32..372 CDD:270247
PBP2_transferrin 450..792 CDD:270247 26/108 (24%)
TR_FER 452..790 CDD:214514 25/106 (24%)
srprbNP_001002572.1 SRPRB 58..237 CDD:255367 40/170 (24%)
SR_beta 61..266 CDD:206691 45/195 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583235
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.