Sequence 1: | NP_524044.1 | Gene: | Tsf2 / 39435 | FlyBaseID: | FBgn0036299 | Length: | 819 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002572.1 | Gene: | srprb / 436845 | ZFINID: | ZDB-GENE-040718-311 | Length: | 266 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 45/195 - (23%) |
---|---|---|---|
Similarity: | 77/195 - (39%) | Gaps: | 44/195 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 381 RNQQDGTNTSILYEKFRIFESKRYGKPNLL---------------FQDSSRALTVIPEDDQSFTK 430
Fly 431 YLGPAINFIYGIRECPV---PAMTLCVTSENELDKCIKMRTALKAHLLKPELICKKMHSHINCMQ 492
Fly 493 FIEAGKADISVFD---AGDVYTG--GLNYDLVPFMSEVYNLGEPEYYVVAVAKEDDPDTELTYLK 552
Fly 553 552 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tsf2 | NP_524044.1 | PBP2_transferrin | 32..372 | CDD:270247 | |
PBP2_transferrin | 450..792 | CDD:270247 | 26/108 (24%) | ||
TR_FER | 452..790 | CDD:214514 | 25/106 (24%) | ||
srprb | NP_001002572.1 | SRPRB | 58..237 | CDD:255367 | 40/170 (24%) |
SR_beta | 61..266 | CDD:206691 | 45/195 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170583235 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |