DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2beta and EIF2 BETA

DIOPT Version :9

Sequence 1:NP_524043.1 Gene:eIF2beta / 39433 FlyBaseID:FBgn0004926 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001078610.1 Gene:EIF2 BETA / 832216 AraportID:AT5G20920 Length:268 Species:Arabidopsis thaliana


Alignment Length:308 Identity:132/308 - (42%)
Similarity:172/308 - (55%) Gaps:69/308 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FDPTLLKKKKKKKTTFDLDAALGLEDDTKKEDPQDEASAEGGAAAEEDNLDL-----ESFGKKKK 66
            |||:  |||||||...              ::|.::. ||.....:.|:|.:     .||...||
plant    18 FDPS--KKKKKKKVVI--------------QEPVEDL-AESSQTEKSDSLPVNDGLESSFTGMKK 65

  Fly    67 KKKKP-----FNMDEIEAAIPSFGGDDVAASEEPEEEEINLDMDFSMAKKKKKSKKKELDELFAD 126
            |||||     .|.:.::|....   |::|..|:..||.|.|...:                    
plant    66 KKKKPTESSLLNNESVDAGEDL---DEIANDEQEGEEGIVLQQRY-------------------- 107

  Fly   127 QADDDKSEDKENDEDNSSTWFGSDRDYTYDELLKRVFEIILDKNPDMAAGRKPKFVMRPPQVLRV 191
                              .|.||:|||.|||||.|||.|:.:.||::|..|: :.|||||||||.
plant   108 ------------------PWEGSERDYIYDELLGRVFNILRENNPELAGDRR-RTVMRPPQVLRE 153

  Fly   192 GTKKTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMDGNQQLIIKGRFQPKQIENVLRRYIKE 256
            |||||.|.||||:.||:||.|.|::.:||||||||||:||.|:|::||||.||..|.:|||||.:
plant   154 GTKKTVFVNFMDLCKTMHRQPDHVMQYLLAELGTSGSLDGQQRLVVKGRFAPKNFEGILRRYITD 218

  Fly   257 YVTCHTCRSPETILQKDTRLFFLQCESCGSRCSVASIKSGFQAVTGKR 304
            ||.|..|:||:|||.|:.|||||:||.|||:.|||.||:||.|...:|
plant   219 YVICLGCKSPDTILSKENRLFFLRCEKCGSQRSVAPIKTGFVARVSRR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2betaNP_524043.1 eIF2B_5 178..287 CDD:214764 70/108 (65%)
EIF2 BETANP_001078610.1 eIF2B_5 140..249 CDD:214764 71/109 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 160 1.000 Domainoid score I1274
eggNOG 1 0.900 - - E1_COG1601
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 229 1.000 Inparanoid score I1148
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1178655at2759
OrthoFinder 1 1.000 - - FOG0004439
OrthoInspector 1 1.000 - - oto3781
orthoMCL 1 0.900 - - OOG6_101265
Panther 1 1.100 - - LDO PTHR23001
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3723
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.