DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2beta and AT5G01940

DIOPT Version :9

Sequence 1:NP_524043.1 Gene:eIF2beta / 39433 FlyBaseID:FBgn0004926 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001331901.1 Gene:AT5G01940 / 831786 AraportID:AT5G01940 Length:247 Species:Arabidopsis thaliana


Alignment Length:198 Identity:77/198 - (38%)
Similarity:115/198 - (58%) Gaps:14/198 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 EEEEINLDMD----FSMAKKKKKSKKKEL---DELFADQADDDKSEDKENDEDNSSTWFGSDRDY 153
            |.|.|:.|..    |..:|||||.|:|.|   |::|. |.....:||...|..:|..:   :.||
plant    45 ELEVIDNDSSWVSKFDPSKKKKKKKQKPLIREDDIFF-QNGGHFTEDNLPDCQSSRKF---EPDY 105

  Fly   154 TYDELLKRVFEIILDKNPDMAAGRKPKFVMRPPQVLRVGTKKTSFANFMDIAKTLHRLPKHLLDF 218
            .|.|||..||:.:.:::.:::..| |:.||.|||:|..|| .|...||.|:.:|:||.|.|::.|
plant   106 GYKELLSMVFDRLREEDVEVSTER-PRTVMMPPQLLAEGT-ITVCLNFADLCRTMHRKPDHVMKF 168

  Fly   219 LLAELGTSGSMDGNQQLIIKGRFQPKQIENVLRRYIKEYVTCHTCRSPETIL-QKDTRLFFLQCE 282
            |||::.|..|::..|:|.|||....|..:.|.|:||..:|.|..|:||:|.| ::...||.|:||
plant   169 LLAQMETKVSLNKQQRLEIKGLVSSKDFQAVFRKYIDAFVICVCCKSPDTALAEEGNGLFNLRCE 233

  Fly   283 SCG 285
            :||
plant   234 TCG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2betaNP_524043.1 eIF2B_5 178..287 CDD:214764 48/109 (44%)
AT5G01940NP_001331901.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1178655at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101265
Panther 1 1.100 - - O PTHR23001
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.