DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2beta and EIF5

DIOPT Version :9

Sequence 1:NP_524043.1 Gene:eIF2beta / 39433 FlyBaseID:FBgn0004926 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001960.2 Gene:EIF5 / 1983 HGNCID:3299 Length:431 Species:Homo sapiens


Alignment Length:110 Identity:33/110 - (30%)
Similarity:57/110 - (51%) Gaps:7/110 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 PPQVLRVGTK----KTSFANFMDIAKTLHRLPKHLLDFLLAELGTSGSMD-GNQQLIIKGRFQPK 244
            |..:.:|..|    ||...|.:|:||.|:|.|.:...:...|||.....| .|.:.|:.|..:..
Human    19 PRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEAN 83

  Fly   245 QIENVLRRYIKEYVTCHTCRSPETILQKDTRLFFL--QCESCGSR 287
            :::::|..:||::|.|..|.:|||.|..:.:...:  .|::||.|
Human    84 KLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYR 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2betaNP_524043.1 eIF2B_5 178..287 CDD:214764 32/108 (30%)
EIF5NP_001960.2 eIF-5_eIF-2B 9..128 CDD:280114 32/108 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..216
W2_eIF5 233..385 CDD:211399
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.