DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and BAZ1B

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_001357331.1 Gene:BAZ1B / 9031 HGNCID:961 Length:1483 Species:Homo sapiens


Alignment Length:156 Identity:43/156 - (27%)
Similarity:70/156 - (44%) Gaps:26/156 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   670 GLPVIPVESIPGLREI-------GWKPQNRP--ARSSRPLEESTDPEK-----LATSFAS----- 715
            ||.:.|.::|.|...:       |.:|..:|  .|.|:|.....|..:     |.|..:|     
Human  1279 GLRLRPRKTIRGKHSVIPPAARSGRRPGKKPHSTRRSQPKAPPVDDAEVDELVLQTKRSSRRQSL 1343

  Fly   716 -------VLQSVRQHTTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADM 773
                   :|..:.::..:|||..|||..|..||||.|.:|||.:|:..:...|.|::.:.|:.||
Human  1344 ELQKCEEILHKIVKYRFSWPFREPVTRDEAEDYYDVITHPMDFQTVQNKCSCGSYRSVQEFLTDM 1408

  Fly   774 ARIFSNCRFYNSPDTEYYRCANSLER 799
            .::|:|...||...:....|....|:
Human  1409 KQVFTNAEVYNCRGSHVLSCMVKTEQ 1434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 43/156 (28%)
Acetyltransf_1 526..598 CDD:278980
Bromo_gcn5_like 708..808 CDD:99941 31/109 (28%)
BAZ1BNP_001357331.1 WAC_Acf1_DNA_bd 21..120 CDD:337781
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..212
C motif 207..213
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..333
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 379..432
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 446..470
DDT 604..668 CDD:214726
DUF5401 <664..>877 CDD:340095
WHIM1 727..767 CDD:339506
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 788..817
WSD 898..1025 CDD:317927
PHD_BAZ1B 1186..1231 CDD:277098
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1237..1326 12/46 (26%)
Bromo_WSTF_like 1344..1440 CDD:99937 28/91 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1455..1483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.