DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and RSC4

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_012933.4 Gene:RSC4 / 853877 SGDID:S000001716 Length:625 Species:Saccharomyces cerevisiae


Alignment Length:318 Identity:74/318 - (23%)
Similarity:113/318 - (35%) Gaps:86/318 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   500 YQLPEMPREYISQLVFDTKH---------KTL-ALIKENQPIGGICFRPF---PSQGFTEIVFCA 551
            |..|..|:   |:|..|..|         .|| .||.:.:.|    |:.|   ||:.|....:..
Yeast    38 YNAPLNPK---SELFLDDWHIPKFNRFISFTLDVLIDKYKDI----FKDFIKLPSRKFHPQYYYK 95

  Fly   552 VTMSEQVKGYGTHLMNHLK--DYSIQRGIKHLLTFADCDAIGYFKKQGFSKDIKLARPVYAGYIK 614
            :.....:        |.:|  ||..:.|                 ...|..|::|.......| .
Yeast    96 IQQPMSI--------NEIKSRDYEYEDG-----------------PSNFLLDVELLTKNCQAY-N 134

  Fly   615 EYDSATLMHCELHPSIVNTQFIAVIRSQSEILKELIAQRHNEV-QKVRPGLTCFKEGLPVIPVES 678
            ||||.          ||......|:..:.|:||....:|:..: .:|:..|..:...| |...|.
Yeast   135 EYDSL----------IVKNSMQVVMLIEFEVLKAKNLKRNYLINSEVKAKLLHYLNKL-VDATEK 188

  Fly   679 IPGLREIGWKPQNRPARSSRPLEESTDPEKLATSFASVLQSVRQHTTAWPFLRPVTAAEVPDYYD 743
            ......:|       |.|.:.|:   |..||:.                ||:..|...|:|:||:
Yeast   189 KINQALLG-------ASSPKNLD---DKVKLSE----------------PFMELVDKDELPEYYE 227

  Fly   744 HIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYF 801
            .:..||.|..:.:.|:.|.|.....|:.||..:|.|...:|.|....|:.|.:|..||
Yeast   228 IVHSPMALSIVKQNLEIGQYSKIYDFIIDMLLVFQNAHIFNDPSALIYKDATTLTNYF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 74/318 (23%)
Acetyltransf_1 526..598 CDD:278980 11/76 (14%)
Bromo_gcn5_like 708..808 CDD:99941 27/94 (29%)
RSC4NP_012933.4 COG5076 40..423 CDD:227408 73/316 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.