powered by:
Protein Alignment Gcn5 and RSC1
DIOPT Version :9
Sequence 1: | NP_648586.2 |
Gene: | Gcn5 / 39431 |
FlyBaseID: | FBgn0020388 |
Length: | 813 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_011570.1 |
Gene: | RSC1 / 852947 |
SGDID: | S000003288 |
Length: | 928 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 69 |
Identity: | 25/69 - (36%) |
Similarity: | 40/69 - (57%) |
Gaps: | 2/69 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 737 EVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYF 801
|.||||..|:.|:.|.|:.:||. :|.:.:.|:.|.|:|..|...||:.|:..|:.|..||.:.
Yeast 43 EYPDYYIIIRNPISLNTLKKRLP--HYTSPQDFVNDFAQIPWNAMTYNAKDSVIYKYAILLESFI 105
Fly 802 QTKM 805
:.|:
Yeast 106 KGKI 109
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5076 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.