DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and RSC1

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_011570.1 Gene:RSC1 / 852947 SGDID:S000003288 Length:928 Species:Saccharomyces cerevisiae


Alignment Length:69 Identity:25/69 - (36%)
Similarity:40/69 - (57%) Gaps:2/69 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   737 EVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYF 801
            |.||||..|:.|:.|.|:.:||.  :|.:.:.|:.|.|:|..|...||:.|:..|:.|..||.:.
Yeast    43 EYPDYYIIIRNPISLNTLKKRLP--HYTSPQDFVNDFAQIPWNAMTYNAKDSVIYKYAILLESFI 105

  Fly   802 QTKM 805
            :.|:
Yeast   106 KGKI 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 25/69 (36%)
Acetyltransf_1 526..598 CDD:278980
Bromo_gcn5_like 708..808 CDD:99941 25/69 (36%)
RSC1NP_011570.1 Bromo_Rsc1_2_I 8..113 CDD:99952 25/69 (36%)
COG5076 115..463 CDD:227408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.