DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and ITC1

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_011382.1 Gene:ITC1 / 852744 SGDID:S000003101 Length:1264 Species:Saccharomyces cerevisiae


Alignment Length:352 Identity:62/352 - (17%)
Similarity:112/352 - (31%) Gaps:121/352 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 LVFYKYNHLSTPE--------------LQTMTEVAKTFLNFLNHYNFESPSTRRGDLTHEDASNY 275
            :|.||...:..|:              ::...|...::..||..::|                  
Yeast     1 MVLYKRKPILLPDPKPLPLDLNVQVWHIEETGEWFSSYEEFLERFDF------------------ 47

  Fly   276 KINYTRWLVFCHVPAFCNSLRQCETSLVFGRTLLRTVFQCM-SQQLKKKCISERDRFPEDKRSII 339
               |||....|.:..                |...|.||.: |::.:.|.:  .||||...|..:
Yeast    48 ---YTRHHFTCEITG----------------TSCLTFFQALDSEETQFKYV--EDRFPLKLREPV 91

  Fly   340 TLMPKFLETLRAELLKDDSPIWDTSYRPSNSF----VIQQRKRNQEVANVPIGPSAASIGGNKRT 400
            .....|....|.:.|     :.....|..|.|    |:..||:...        |..|....:.|
Yeast    92 ARFLHFNGIRRLDAL-----VEKVYARFKNDFFPGEVVYLRKQKDS--------STTSSNSQQST 143

  Fly   401 ----------SVGEP------------LHKRIKKEPTDRPSSENLDDLPADVVMRAMKS---VSE 440
                      |||.|            :.::::...|..|.|.       ::||.|...   :.|
Yeast   144 PQPDDMVEINSVGNPGLPQYQYQRRYVIKEKVQFNATINPESR-------EIVMPAHTKYMLIEE 201

  Fly   441 SKTTNKAEILFPVNVSRDENVKAEEQKRAIEFHVVGNSLTKPVDKQTVLWLLGLQLVFAYQLP-E 504
            :.::||:.|:....:.||.:...:...:.. |.:   :|.:...|....|.:..:.:..|.|. |
Yeast   202 AASSNKSFIVDQGQIYRDRSTFTKHLIKCF-FKI---TLQRASSKMGAPWCVKPEYLAMYGLTME 262

  Fly   505 MPREYISQLVFDTKHKTLALIKENQPI 531
            .|::.:.             .||::|:
Yeast   263 WPKDMLK-------------YKEDEPV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997 17/111 (15%)
COG5076 451..807 CDD:227408 13/82 (16%)
Acetyltransf_1 526..598 CDD:278980 3/6 (50%)
Bromo_gcn5_like 708..808 CDD:99941
ITC1NP_011382.1 WAC_Acf1_DNA_bd 24..124 CDD:402251 25/143 (17%)
DDT 423..483 CDD:214726
WSD 869..952 CDD:406128
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.