DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and BDF2

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_010213.1 Gene:BDF2 / 851488 SGDID:S000002228 Length:638 Species:Saccharomyces cerevisiae


Alignment Length:135 Identity:35/135 - (25%)
Similarity:67/135 - (49%) Gaps:12/135 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   677 ESIPGLREIGWKPQNRPARSSRPLEESTDPEKL----ATSFASVLQSVRQHTTAWPFLRPV--TA 735
            ||.|. ..:|.:.:..||     ||...:.|:|    :....|.:::.::...|.|||:||  .|
Yeast   108 ESFPE-HPLGLERETEPA-----LEAEMEAEELPPHQSKYLLSSIKATKRLKDARPFLKPVDPIA 166

  Fly   736 AEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERY 800
            ..:|.|:::::.||||..:..:|:...|.:.....:|...:..||..:|.|::.....|..:::|
Yeast   167 LNIPHYFNYVQTPMDLSLIETKLQGNVYHSVEQVTSDFKTMVDNCLNFNGPESSISSMAKRIQKY 231

  Fly   801 FQTKM 805
            |:.|:
Yeast   232 FEKKL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 35/135 (26%)
Acetyltransf_1 526..598 CDD:278980
Bromo_gcn5_like 708..808 CDD:99941 26/104 (25%)
BDF2NP_010213.1 COG5076 55..378 CDD:227408 35/135 (26%)
Bromodomain <344..419 CDD:413371
Lebercilin <472..>537 CDD:406132
BET 521..576 CDD:407211
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.