DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and AT5G55040

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_001119438.1 Gene:AT5G55040 / 835595 AraportID:AT5G55040 Length:916 Species:Arabidopsis thaliana


Alignment Length:125 Identity:38/125 - (30%)
Similarity:61/125 - (48%) Gaps:2/125 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   688 KPQNRPARSSRPLEES--TDPEKLATSFASVLQSVRQHTTAWPFLRPVTAAEVPDYYDHIKYPMD 750
            |.:.|.:.|....:.|  |.|.....|...:|..:::......:..||...|:|||:|.|::|||
plant   164 KERKRRSASGNQCDHSSETTPILDKKSLELILDKLQKKDIYGVYAEPVDPEELPDYHDMIEHPMD 228

  Fly   751 LKTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYFQTKMRELGL 810
            ..|:.::|..|.|.|.....:|:..|.||...|||.||.||:.|.:::...:.|..:..|
plant   229 FSTVRKKLANGSYSTLEELESDVLLICSNAMQYNSSDTVYYKQARTIQEMGKRKFEKARL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 37/120 (31%)
Acetyltransf_1 526..598 CDD:278980
Bromo_gcn5_like 708..808 CDD:99941 31/99 (31%)
AT5G55040NP_001119438.1 Bromodomain 187..283 CDD:99922 30/95 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.