DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and BRDT

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_001229735.2 Gene:BRDT / 676 HGNCID:1105 Length:951 Species:Homo sapiens


Alignment Length:130 Identity:43/130 - (33%)
Similarity:65/130 - (50%) Gaps:14/130 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   693 PARSSRPLEESTDPEKLATSFAS------------VLQSVRQHTTAWPFLRPVTAA--EVPDYYD 743
            |:|.:..:.....||.:.|....            ||:.:.:|:.:|||.|||.|.  ::||||.
Human     4 PSRQTAIIVNPPPPEYINTKKNGRLTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYT 68

  Fly   744 HIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYFQTKMREL 808
            .||.||||.|:.:||:..||......:.|...:||||..||.|..:....|.:||:.|..|:.::
Human    69 IIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQM 133

  Fly   809  808
            Human   134  133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 43/127 (34%)
Acetyltransf_1 526..598 CDD:278980
Bromo_gcn5_like 708..808 CDD:99941 39/113 (35%)
BRDTNP_001229735.2 Bromo_Brdt_I_like 27..133 CDD:99929 38/105 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..232
Nuclear localization signal. /evidence=ECO:0000269|PubMed:22971749 213..224
Bromo_Brdt_II_like 276..377 CDD:99930
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..424
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 448..515
BET 513..575 CDD:293640
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 614..702
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 886..928
BRD4_CDT 909..951 CDD:293710
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.