DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and Pbrm1

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_001074720.1 Gene:Pbrm1 / 66923 MGIID:1923998 Length:1704 Species:Mus musculus


Alignment Length:516 Identity:106/516 - (20%)
Similarity:177/516 - (34%) Gaps:142/516 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 KKEPTDRPSSE---NLDD----LPADVVMRAMKSVSESKTTNKA----EILFPVNVSRDEN---- 460
            |:.....|||.   :.||    :|.....|..:.:|...|.:..    |:...:...:||.    
Mouse     4 KRRRATSPSSSVSGDFDDGHHSVPTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLL 68

  Fly   461 ----VKAEEQKRAIEFHVVGNSLTKPVDKQTV-------------LWLLGLQLVF----AYQLPE 504
                ::|.:::...:::.|   :::|:|...:             |.....||:|    ||..|:
Mouse    69 CELFIRAPKRRNQPDYYEV---VSQPIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKAYYKPD 130

  Fly   505 MPREY-----ISQLVFDTKHK---------------------TLA------LIKE--NQPIGGIC 535
            .| ||     :..|...|:::                     |||      .:||  .|.:..|.
Mouse   131 SP-EYKAACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTLADGSSPGYLKEILEQLLEAIV 194

  Fly   536 FRPFPSQGFTEIVFCAVTMSEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKK-QGFS 599
            ....||......:|..:....|...|          |:|.:....|.|.|.....|.:|. ...:
Mouse   195 VATNPSGRLISELFQKLPSKVQYPDY----------YAIIKEPIDLKTIAQRIQNGSYKSIHAMA 249

  Fly   600 KDIKLARPVYAGYIKEYD--------------------SATLMHCELHPSIVNTQFIAVIRSQSE 644
            |||.|    .|...|.|:                    .|.:.|.|:..|.:.      ||:.|.
Mouse   250 KDIDL----LAKNAKTYNEPGSQVFKDANSIKKIFYMKKAEIEHHEMTKSSLR------IRTASN 304

  Fly   645 IL----------KELIAQRHNEVQKVRPGLTCFKEGLPVIPVESIPGLREIGWKPQNRPARSSRP 699
            :.          |..:.:..|...|........:.|    .:.:|....:.|.:.:...|.::..
Mouse   305 LAAARLTGPSHNKSSLGEERNPTSKYYRNKRAVQGG----RLSAITMALQYGSESEEDAALAAAR 365

  Fly   700 LEESTDPEKLATSFASV----------LQSVRQH---TTAWPFLRPVTAAEVPDYYDHIKYPMDL 751
            .||.....:..|||..|          ::|.|.|   ..|.||....:..:.||||..||.|:.|
Mouse   366 YEEGESEAESITSFMDVSNPFHQLYDTVRSCRNHQGQLIAEPFFHLPSKKKYPDYYQQIKMPISL 430

  Fly   752 KTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYFQTKMRELGLWD 812
            :.:..:||...|:|......|:..:|.|.:.||.|::..|:....|::..|.|.:||...|
Mouse   431 QQIRTKLKNQEYETLDHLECDLNLMFENAKRYNVPNSAIYKRVLKLQQVMQAKKKELARRD 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 92/458 (20%)
Acetyltransf_1 526..598 CDD:278980 16/74 (22%)
Bromo_gcn5_like 708..808 CDD:99941 32/112 (29%)
Pbrm1NP_001074720.1 Bromo_polybromo_I 44..156 CDD:99954 19/115 (17%)
Bromo_polybromo_II 182..284 CDD:99948 23/115 (20%)
Bromo_polybromo_III 383..484 CDD:99951 27/100 (27%)
Bromo_polybromo_IV 534..637 CDD:99949
Bromo_polybromo_V 673..777 CDD:99946
Bromo_polybromo_VI 790..897 CDD:99956
BAH_polybromo 972..1089 CDD:240068
BAH_polybromo 1170..1288 CDD:240068
HMG-box 1395..1459 CDD:238037
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.