DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Gcn5 and brd4

DIOPT Version :9

Sequence 1:	NP_648586.2	Gene:	Gcn5 / 39431	FlyBaseID:	FBgn0020388	Length:	813	Species:	Drosophila melanogaster
Sequence 2:	NP_001104751.1	Gene:	brd4 / 570531	ZFINID:	ZDB-GENE-030131-267	Length:	1444	Species:	Danio rerio

Alignment Length:	118	Identity:	42/118 - (35%)
Similarity:	64/118 - (54%)	Gaps:	2/118 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   693 PARSSRPLEESTDPEKLATSFASVLQSVRQHTTAWPFLRPVTAAE--VPDYYDHIKYPMDLKTMG 755
            |..:|.|........:|......||:|:.:|..||||..||.|.:  :||||..||.|||:.|:.
Zfish    32 PPETSNPTRPKRQTNQLQYLLKVVLKSLWKHQFAWPFHAPVDAVKLNLPDYYKIIKNPMDMGTIK 96

  Fly   756 ERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYFQTKMREL 808
            :||:..:|.:.:..:.|...:|:||..||.|..:....|.:||:.|.||:.|:
Zfish    97 KRLESAFYTSAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKVFLTKISEM 149

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Gcn5	NP_648586.2	PCAF_N	73..322	CDD:283997
		COG5076	451..807	CDD:227408	41/115 (36%)
		Acetyltransf_1	526..598	CDD:278980
		Bromo_gcn5_like	708..808	CDD:99941	38/101 (38%)
brd4	NP_001104751.1	bromodomain 1; BD1	40..152		39/110 (35%)
		Bromo_Brdt_I_like	43..149	CDD:99929	38/105 (36%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	154..217
		bromodomain 2; BD2	356..473
		Bromo_Brdt_II_like	363..464	CDD:99930
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	492..523
		NPS region. /evidence=ECO:0000250	498..517
		BID region. /evidence=ECO:0000250	538..610
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	540..645
		ET domain	654..729
		BET	657..721	CDD:293640
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1020..1422
		C-terminal (CTD) region. /evidence=ECO:0000250	1126..1444
		BRD4_CDT	<1419..1444	CDD:293710
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5076
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.810