DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and nej

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_001188575.1 Gene:nej / 43856 FlyBaseID:FBgn0261617 Length:3282 Species:Drosophila melanogaster


Alignment Length:139 Identity:38/139 - (27%)
Similarity:62/139 - (44%) Gaps:21/139 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   692 RPARSSRPLEEST--------------DPEKLATSFASVLQSV-RQHTTAWPFLRPV--TAAEVP 739
            :|...::||....              :||:|.|:....|:.: ||...:.||..||  .|..:|
  Fly  1677 KPKTETKPLVPEPLAPNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGIP 1741

  Fly   740 DYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYFQTK 804
            ||::.:|.||||.|:...::.|.|.....::.|:..:|.|...||...:..||....|...|:.:
  Fly  1742 DYFEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFEAE 1806

  Fly   805 ----MRELG 809
                |:.||
  Fly  1807 IDPVMQALG 1815

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 36/135 (27%)
Acetyltransf_1 526..598 CDD:278980
Bromo_gcn5_like 708..808 CDD:99941 31/106 (29%)
nejNP_001188575.1 ZnF_TAZ 530..600 CDD:214717
KIX 946..1024 CDD:280354
Bromo_cbp_like 1705..1812 CDD:99927 32/106 (30%)
RING_CBP-p300 1824..1906 CDD:276805
PHD_CBP_p300 1908..1939 CDD:277032
HAT_KAT11 1970..2283 CDD:285432
ZZ_CBP 2339..2379 CDD:239077
ZnF_TAZ 2404..2476 CDD:214717
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.