DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and Brd8

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_651685.2 Gene:Brd8 / 43460 FlyBaseID:FBgn0039654 Length:872 Species:Drosophila melanogaster


Alignment Length:185 Identity:45/185 - (24%)
Similarity:62/185 - (33%) Gaps:59/185 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   640 RSQSEILKE--LIAQRHNEVQKVRPGLTCFKEGLPVIPVESIPGLREIGWKPQNRPARSSRPLEE 702
            ||:|.::.:  ..|..|:..:..|  ..|  ...|||  :|||          |.||.|     |
  Fly   677 RSESPMVDDDATTASDHSTARSTR--RRC--SSTPVI--DSIP----------NSPASS-----E 720

  Fly   703 STDP--EKLATS---FASVLQSVRQHTTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGY 762
            .||.  |..|.|   |.|:...:.....|.||.||........:.|....|||..|:...:..|:
  Fly   721 HTDDRRETRAASKKLFLSIYAMLLDSKHAAPFKRPFHDEHAQRHADLCLRPMDFPTIKRNIDSGF 785

  Fly   763 ----------------------------YQTRRLFMADMARIFSNCRFYNSPDTE 789
                                        ::|.|||:.|...|   ..|...||.:
  Fly   786 IRSLSELHRDVLLMAHNVLVAYKPHTAQHKTARLFVQDCQAI---KEFSQLPDVQ 837

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 45/185 (24%)
Acetyltransf_1 526..598 CDD:278980
Bromo_gcn5_like 708..808 CDD:99941 24/113 (21%)
Brd8NP_651685.2 PaaSYMP <105..188 CDD:291408
PHA03249 402..>582 CDD:223023
Bromo_brd8_like 729..833 CDD:99939 22/106 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.