DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and dikar

DIOPT Version :10

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_001261480.1 Gene:dikar / 38747 FlyBaseID:FBgn0261934 Length:3261 Species:Drosophila melanogaster


Alignment Length:78 Identity:22/78 - (28%)
Similarity:37/78 - (47%) Gaps:13/78 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 VGTEAHTAMTEYDRTEKDVTPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLT-QTSRLA 354
            |||......|.:.  |:|     |||....|:..:|::.|.|:.  ..:||.   |.| :|...:
  Fly   454 VGTVGFLWATRHH--EED-----GFPDVKRVRIAFLILGGVCIA--GMIVTY---LFTRETMGRS 506

  Fly   355 LEEIKLKFIDTAS 367
            |||.:.:.:.|::
  Fly   507 LEENEDEIVSTSA 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..320 CDD:461923 9/28 (32%)
COG5076 451..807 CDD:227408
Bromo_gcn5_like 708..808 CDD:99941
dikarNP_001261480.1 Bromo_gcn5_like 892..991 CDD:99941
PTZ00449 <1941..2257 CDD:185628
PRK10263 <2224..>2332 CDD:236669
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.