DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and Brd4

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_001094373.1 Gene:Brd4 / 362844 RGDID:1307282 Length:1403 Species:Rattus norvegicus


Alignment Length:131 Identity:47/131 - (35%)
Similarity:72/131 - (54%) Gaps:10/131 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   688 KPQNRPARSSR-PLEESTDPEK-------LATSFASVLQSVRQHTTAWPFLRPVTAAE--VPDYY 742
            :||:..|.|:. |..|:::|.|       |......||:::.:|..||||.:||.|.:  :||||
  Rat    34 QPQSANAASTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYY 98

  Fly   743 DHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYFQTKMRE 807
            ..||.|||:.|:.:||:..||...:..:.|...:|:||..||.|..:....|.:||:.|..|:.|
  Rat    99 KIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINE 163

  Fly   808 L 808
            |
  Rat   164 L 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 45/128 (35%)
Acetyltransf_1 526..598 CDD:278980
Bromo_gcn5_like 708..808 CDD:99941 38/108 (35%)
Brd4NP_001094373.1 Bromo_Brdt_I_like 58..164 CDD:99929 37/105 (35%)
Bromo_Brdt_II_like 354..455 CDD:99930
BET 610..674 CDD:293640
BRD4_CDT 1361..1403 CDD:293710
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.