DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and baz1a

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_001352072.1 Gene:baz1a / 334173 ZFINID:ZDB-GENE-030131-6105 Length:1470 Species:Danio rerio


Alignment Length:171 Identity:51/171 - (29%)
Similarity:80/171 - (46%) Gaps:33/171 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   671 LPVIPVESIPGLREIGWKPQNRPARSS-----RPLEESTDPEK---LA--TSFASVLQSVR---- 721
            |.||......|..|     |:.||..:     ||:.....|:.   ||  |:.:|...|.|    
Zfish  1295 LEVISTNDTTGKSE-----QSSPAAGNAESRKRPITAEVSPKSKIILAPTTTSSSRRSSGRNLGV 1354

  Fly   722 --------------QHTTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMAD 772
                          :|..:|||::.|:..:||||||.||.|:.|.|:.|::....|||...::.|
Zfish  1355 HELSACELLSVDLVRHEDSWPFMKLVSRTQVPDYYDIIKKPIALSTIREKVNNCEYQTAAEYIED 1419

  Fly   773 MARIFSNCRFYNSPDTEYYRCANSLERYFQTKMRELGLWDK 813
            :..:||||..||..:|...:....|:.:|.::::.|||.|:
Zfish  1420 VELMFSNCLEYNPHNTNEAKAGLRLQAFFHSELQRLGLADR 1460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 47/163 (29%)
Acetyltransf_1 526..598 CDD:278980
Bromo_gcn5_like 708..808 CDD:99941 36/122 (30%)
baz1aNP_001352072.1 WAC_Acf1_DNA_bd 23..122 CDD:313708
DDT 406..467 CDD:214726
WHIM1 570..615 CDD:317926
Neuromodulin_N <618..747 CDD:331332
WSD 759..875 CDD:317927
PHD_BAZ1A 1118..1163 CDD:277097
Bromodomain 1353..1457 CDD:321986 31/103 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594397
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.