DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and brdt

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:XP_002662470.2 Gene:brdt / 333996 ZFINID:ZDB-GENE-030131-5928 Length:1093 Species:Danio rerio


Alignment Length:129 Identity:43/129 - (33%)
Similarity:65/129 - (50%) Gaps:9/129 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   689 PQNRPARSSRPLEESTDPEK-------LATSFASVLQSVRQHTTAWPFLRPVTAA--EVPDYYDH 744
            ||:.....:.|..|..:|:|       |......|::::.:|..:|||.:||.|.  .:||||..
Zfish     7 PQHFTMNGNPPPPEFKNPKKPGRLTNHLQYIEKVVIRALWKHHFSWPFRQPVDAVRLNLPDYYTI 71

  Fly   745 IKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYFQTKMREL 808
            ||.||||.|:.:||:..||......:.|...:|:||..||.|..:....|..||:.|..|:.|:
Zfish    72 IKNPMDLTTIRKRLENNYYWKAMECVEDFNTMFTNCYVYNRPGDDIVLMAQVLEKLFLEKVAEM 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 42/126 (33%)
Acetyltransf_1 526..598 CDD:278980
Bromo_gcn5_like 708..808 CDD:99941 37/108 (34%)
brdtXP_002662470.2 Bromo_Brdt_I_like 29..135 CDD:99929 36/105 (34%)
Bromo_Brdt_II_like 273..373 CDD:99930
BET 514..577 CDD:293640
BRD4_CDT 1050..1093 CDD:293710
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594399
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.