Sequence 1: | NP_648586.2 | Gene: | Gcn5 / 39431 | FlyBaseID: | FBgn0020388 | Length: | 813 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001116861.1 | Gene: | brd3a / 327372 | ZFINID: | ZDB-GENE-030131-6141 | Length: | 683 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 54/200 - (27%) |
---|---|---|---|
Similarity: | 88/200 - (44%) | Gaps: | 19/200 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 628 PSIVNTQFIAVI----RSQSEILKELIAQRHNEVQKVRPGLTCFKEGLPVIPVE----SIPGLRE 684
Fly 685 IGWKPQNRPARSSRPLE---------ESTDPEKLATSFASVLQSVRQHTTAWPFLRPV--TAAEV 738
Fly 739 PDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYFQT 803
Fly 804 KMREL 808 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gcn5 | NP_648586.2 | PCAF_N | 73..322 | CDD:283997 | |
COG5076 | 451..807 | CDD:227408 | 54/197 (27%) | ||
Acetyltransf_1 | 526..598 | CDD:278980 | |||
Bromo_gcn5_like | 708..808 | CDD:99941 | 37/101 (37%) | ||
brd3a | NP_001116861.1 | Bromo_Brdt_I_like | 30..136 | CDD:99929 | |
Bromo_Brdt_II_like | 295..396 | CDD:99930 | 37/100 (37%) | ||
BET | 574..638 | CDD:293640 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5076 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |