DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and brd3a

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_001116861.1 Gene:brd3a / 327372 ZFINID:ZDB-GENE-030131-6141 Length:683 Species:Danio rerio


Alignment Length:200 Identity:54/200 - (27%)
Similarity:88/200 - (44%) Gaps:19/200 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   628 PSIVNTQFIAVI----RSQSEILKELIAQRHNEVQKVRPGLTCFKEGLPVIPVE----SIPGLRE 684
            |::.||...|||    .||..:.|:.:.::.:........:|..:...|...:|    .:...||
Zfish   200 PAVQNTTAAAVIPSMPPSQPTVKKKGVKRKADTTTPTTSAITASRSQSPTPILEGKQSKVAARRE 264

  Fly   685 IGWKPQNRPARSSRPLE---------ESTDPEKLATSFASVLQSVRQHTTAWPFLRPV--TAAEV 738
            ...:|...|.:.....|         ..::..|........:.|.:....||||.:||  .|.|:
Zfish   265 STGRPIKPPKKDFEDGELGVHGGKKGRLSEQLKYCDVILKEMLSKKHAAYAWPFYKPVDAEALEL 329

  Fly   739 PDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYFQT 803
            .||:|.||:||||.|:.:::....||..:.|.||:..:||||..||.||.|....|..|:..|:.
Zfish   330 HDYHDIIKHPMDLSTVKKKMDSREYQDAQTFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEM 394

  Fly   804 KMREL 808
            :..::
Zfish   395 RFAKM 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 54/197 (27%)
Acetyltransf_1 526..598 CDD:278980
Bromo_gcn5_like 708..808 CDD:99941 37/101 (37%)
brd3aNP_001116861.1 Bromo_Brdt_I_like 30..136 CDD:99929
Bromo_Brdt_II_like 295..396 CDD:99930 37/100 (37%)
BET 574..638 CDD:293640
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.