DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and brd2a

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_571275.2 Gene:brd2a / 30445 ZFINID:ZDB-GENE-990415-248 Length:836 Species:Danio rerio


Alignment Length:159 Identity:52/159 - (32%)
Similarity:83/159 - (52%) Gaps:14/159 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   663 GLTCFKEGLPVIPVESI--PGLREIGWKPQNRP--ARSSRPLEESTDPEK-------LATSFASV 716
            |||..::.:.. |.:.|  |.|...|::....|  |:|..|.....||.:       |.....::
Zfish    21 GLTMMEQTISG-PGKRIRKPSLLYEGFEGPALPHIAQSGPPQPAVRDPSRQGRMTNQLQFLQKAL 84

  Fly   717 LQSVRQHTTAWPFLRPVTAAE--VPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSN 779
            ::::.:|..||||..||.||:  :||||:.||.|||:.|:.:||:..||::....|.|...:|:|
Zfish    85 VKTLWRHHFAWPFHEPVDAAKLNLPDYYNIIKQPMDMGTIKKRLENNYYRSASECMQDFNTMFTN 149

  Fly   780 CRFYNSPDTEYYRCANSLERYFQTKMREL 808
            |..||.|..:....|.|||:.|..|:.::
Zfish   150 CYIYNKPTDDIVLMAQSLEKAFLQKVAQM 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 52/156 (33%)
Acetyltransf_1 526..598 CDD:278980
Bromo_gcn5_like 708..808 CDD:99941 38/108 (35%)
brd2aNP_571275.2 Bromo_Brdt_I_like 72..178 CDD:99929 38/105 (36%)
Bromo_Brdt_II_like 383..484 CDD:99930
BET 676..738 CDD:293640
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.