DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and tbrd-3

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster


Alignment Length:118 Identity:34/118 - (28%)
Similarity:54/118 - (45%) Gaps:13/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   702 ESTDPEKLATS------FASVLQSVRQHTTAWPFLRPV--TAAEVPDYYDHIKYPMDLKTMGERL 758
            |.:.||..|..      |:|..:::     ||.|..|:  ....:.||::.::.||||.|:..||
  Fly     8 ERSSPEINACKVIIKRLFSSTYKNI-----AWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRL 67

  Fly   759 KKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYFQTKMRELGLW 811
            ..|.|.:...|..|:..||.|...|.:||...|..|..|:..|:....::.|:
  Fly    68 NTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQLY 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 33/112 (29%)
Acetyltransf_1 526..598 CDD:278980
Bromo_gcn5_like 708..808 CDD:99941 30/107 (28%)
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 31/105 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468252
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.