DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and F22F1.3

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_509376.2 Gene:F22F1.3 / 184851 WormBaseID:WBGene00017715 Length:245 Species:Caenorhabditis elegans


Alignment Length:280 Identity:48/280 - (17%)
Similarity:86/280 - (30%) Gaps:118/280 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 LKKKC---ISERDRFPEDKRSIITLMPKFLETLRAELLKDDSPIWDTSYRPSNSFVIQQRKRNQE 381
            ::||.   :..:|.:..:...||..|.|.|::                 ||..|:       ...
 Worm    56 MEKKSFEKVQTKDEYYAELARIILSMQKHLQS-----------------RPKGSY-------EDP 96

  Fly   382 VANVPIGPSAASIGGNKRTSVGEPLHKRIKKEPTDRPSSENLDDLPADVVMRAMKSVSESKTTNK 446
            .:|:|                               ||.|..|.|......|           ::
 Worm    97 YSNIP-------------------------------PSHELADFLGLSAQER-----------DE 119

  Fly   447 AEILFPVNVSRDENVKAEEQKRAIEFHVVGNSLTKPVDKQTVLWLLGLQLVFAYQLPEMPREYIS 511
            ..:|.|..:.: .|.|:...:| |..||        :||      |||.|   :..|:....|..
 Worm   120 FYLLHPHRLLK-PNAKSRITRR-IRIHV--------IDK------LGLML---FPAPDQNAYYDG 165

  Fly   512 QLVFDTKHKTLALIKENQPIGGICFRPFPSQGFTEIVFC----------AVTMSEQVKGYGTHLM 566
            ::.        .:|::        .|...::.|.|.:.|          |..:.:.:|..|.|.:
 Worm   166 RMD--------RIIRK--------LRNLEAEAFRECIDCDDYYNLASIKAYKLHKTMKKNGEHYV 214

  Fly   567 NHLKDYSIQRGIKHLLTFAD 586
            :|    .::....|:.|.|:
 Worm   215 DH----EVKYPAIHIYTSAN 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997 0/1 (0%)
COG5076 451..807 CDD:227408 28/146 (19%)
Acetyltransf_1 526..598 CDD:278980 12/71 (17%)
Bromo_gcn5_like 708..808 CDD:99941
F22F1.3NP_509376.2 KIX 7..87 CDD:280354 8/30 (27%)
KIX 128..208 CDD:280354 20/114 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.