DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and C29F9.5

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:NP_001355379.1 Gene:C29F9.5 / 183022 WormBaseID:WBGene00016220 Length:261 Species:Caenorhabditis elegans


Alignment Length:261 Identity:47/261 - (18%)
Similarity:85/261 - (32%) Gaps:89/261 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   556 EQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKKQGFSKDIKLARPVYAGYIKEYDSAT 620
            :|.....|..||.|    |.|.:..||...:|          ..:|||:....     ::.:.|.
 Worm    26 QQQPRVSTATMNTL----ISRQLGLLLHAHEC----------VRRDIKIREAA-----EKNEPAP 71

  Fly   621 LMHCELHPSIVNTQFIAVIRSQSEILKELIAQRH----NEVQ--KVRPGLT----CFKEGLPVIP 675
            ...|::...::          ..|:||.:.:.:.    |.|.  ..|..|:    ||.|..||. 
 Worm    72 HAMCKIQDCVI----------MKEVLKHMTSCKEGPKCNSVHCASSRTILSHWKKCFNEECPVC- 125

  Fly   676 VESIPGLREIGWKP----QNRPARSSRPLEESTDPEKLATSFASVLQSVRQHTTAWPFLRPVTAA 736
                        ||    :..|.:.:.|.|    |:|            .:|...|         
 Worm   126 ------------KPIIEQRTAPPQDTTPAE----PKK------------PEHDQIW--------- 153

  Fly   737 EVPDYYDHIKYPMDLKT-MGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERY 800
                   |::.|...:: :.|::.||.....:......|::.:...:..|.:.:.:..|..||.|
 Worm   154 -------HLEVPKTYRSELIEKIYKGIMSNVKPGTLSEAQMDTWKEYSRSAELQIFDTAQKLEAY 211

  Fly   801 F 801
            :
 Worm   212 Y 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 47/261 (18%)
Acetyltransf_1 526..598 CDD:278980 10/41 (24%)
Bromo_gcn5_like 708..808 CDD:99941 14/95 (15%)
C29F9.5NP_001355379.1 ZnF_TAZ 40..128 CDD:214717 23/125 (18%)
KIX 153..223 CDD:280354 12/76 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.