DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcn5 and Crebbp

DIOPT Version :9

Sequence 1:NP_648586.2 Gene:Gcn5 / 39431 FlyBaseID:FBgn0020388 Length:813 Species:Drosophila melanogaster
Sequence 2:XP_006521814.1 Gene:Crebbp / 12914 MGIID:1098280 Length:2451 Species:Mus musculus


Alignment Length:179 Identity:45/179 - (25%)
Similarity:85/179 - (47%) Gaps:15/179 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   639 IRSQSEILKEL-IAQRHNEVQKVRPGLTCFKEGLPVIPVESIPGLREIGWKPQNRPARSSRPLEE 702
            ::..|::.:|. ..::.:|..:|       :|..|.:.||:............::....|:|.::
Mouse  1027 LQGSSQVKEETDTTEQKSEPMEV-------EEKKPEVKVEAKEEEENSSNDTASQSTSPSQPRKK 1084

  Fly   703 STDPEKLATSFASVLQSV-RQHTTAWPFLRPV--TAAEVPDYYDHIKYPMDLKTMGERLKKGYYQ 764
            ...||:|..:....|::: ||...:.||.:||  ....:|||:|.:|.||||.|:..:|..|.||
Mouse  1085 IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQ 1149

  Fly   765 TRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYFQTK----MRELG 809
            ....::.|:..:|:|...||...:..|:..:.|...|:.:    |:.||
Mouse  1150 EPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG 1198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gcn5NP_648586.2 PCAF_N 73..322 CDD:283997
COG5076 451..807 CDD:227408 43/175 (25%)
Acetyltransf_1 526..598 CDD:278980
Bromo_gcn5_like 708..808 CDD:99941 31/106 (29%)
CrebbpXP_006521814.1 zf-TAZ 362..429 CDD:366931
KIX 586..666 CDD:366953
PHA03247 <687..1037 CDD:223021 1/9 (11%)
COG5076 942..>1194 CDD:227408 42/173 (24%)
Bromo_cbp_like 1088..1195 CDD:99927 32/106 (30%)
RING_CBP-p300 1207..1289 CDD:276805
PHD_CBP_p300 1291..1322 CDD:277032
HAT_KAT11 1353..>1564 CDD:369758
ZZ_CBP 1716..1756 CDD:239077
ZnF_TAZ 1777..1855 CDD:214717
Med15 1971..>2422 CDD:312941
Creb_binding 2045..2125 CDD:370251
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.