DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tral and AT4G19275

DIOPT Version :9

Sequence 1:NP_001261775.1 Gene:tral / 39430 FlyBaseID:FBgn0041775 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001328104.1 Gene:AT4G19275 / 827674 AraportID:AT4G19275 Length:208 Species:Arabidopsis thaliana


Alignment Length:85 Identity:27/85 - (31%)
Similarity:51/85 - (60%) Gaps:7/85 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LGSKISLISKADIRYEGRLYTVDPQECTIALSS-VRSFGTE-DRDTQ---FQIAPQSQIYDYILF 67
            :|..::::|..||||||.:..::.|:..:.|.: ||.:|.| :.|.:   ||:.  .:::.:::|
plant    20 IGKFVAVMSNNDIRYEGVISLLNLQDSKLGLQNVVRVYGREVENDNEQRVFQVL--KEVHSHMVF 82

  Fly    68 RGSDIKDIRVVNNHTLPHHN 87
            ||||||.:.|::......||
plant    83 RGSDIKSVEVLSLPPPARHN 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tralNP_001261775.1 LSm14_N 4..77 CDD:212483 24/73 (33%)
FDF 406..536 CDD:286601
AT4G19275NP_001328104.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13586
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.