powered by:
Protein Alignment tral and AT4G19260
DIOPT Version :9
Sequence 1: | NP_001261775.1 |
Gene: | tral / 39430 |
FlyBaseID: | FBgn0041775 |
Length: | 657 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_193661.1 |
Gene: | AT4G19260 / 827666 |
AraportID: | AT4G19260 |
Length: | 288 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 24/71 - (33%) |
Similarity: | 45/71 - (63%) |
Gaps: | 7/71 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 LGSKISLISKADIRYEGRLYTVDPQECTIALSS-VRSFGTE-DRDTQ---FQIAPQSQIYDYILF 67
:|..::::|..||||||.:..::.|:..:.|.: ||.:|.| :.|.: ||:. .:::.:::|
plant 20 IGKFVAVMSNNDIRYEGVISLLNLQDSKLGLQNVVRVYGREVENDNEQRVFQVL--KEVHSHMVF 82
Fly 68 RGSDIK 73
||||||
plant 83 RGSDIK 88
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1073 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR13586 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.