DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sti and AT1G03920

DIOPT Version :9

Sequence 1:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster
Sequence 2:NP_001323295.1 Gene:AT1G03920 / 839369 AraportID:AT1G03920 Length:569 Species:Arabidopsis thaliana


Alignment Length:429 Identity:145/429 - (33%)
Similarity:224/429 - (52%) Gaps:79/429 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 DKDTLKKRDRNIAEFVNKFRPIIEETRKLR-----VNADDFLIKTLIGQGYFGNVHLVVERQTND 137
            |.|..::...|:.:|:.|     :||..:|     :.||||.:.|:||:|.||.|.:|.|..|..
plant   102 DADVCEEDQTNLMKFLEK-----KETEYMRLQRHKMGADDFELLTMIGKGAFGEVRVVREINTGH 161

  Fly   138 IYAMKKIKKSVV----TTSQVKEERDIMSIRNSEWLINLQYAFQDNDNLYLVMEYMPGGDLLSLM 198
            ::||||:|||.:    ....|:.||::::..:|..::.|..:||||:.|||:|||:||||:::|:
plant   162 VFAMKKLKKSEMLRRGQVEHVRAERNLLAEVDSNCIVKLYCSFQDNEYLYLIMEYLPGGDMMTLL 226

  Fly   199 SRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENILIDRFGHIKLADFGNAAALD----- 258
            .|.....||.|:||:||..:|:.::|...|:||||||:|:|:||:||::|:|||....||     
plant   227 MRKDTLSEDEAKFYIAESVLAIESIHNRNYIHRDIKPDNLLLDRYGHLRLSDFGLCKPLDCSVID 291

  Fly   259 ----------------------------------RDGHVLSLSPVGTPDYIAPELLQTISTYKLS 289
                                              ::..:|:.|.||||||||||:|       |.
plant   292 GEDFTVGNAGSGGGSESVSTTPKRSQQEQLEHWQKNRRMLAYSTVGTPDYIAPEVL-------LK 349

  Fly   290 KSMHDVSRIVSCDYWSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELISFPADLKVS 354
            |...     :.||:||:|.|.||::....||:.|:...|..||::.  ::|||    ||.:.::|
plant   350 KGYG-----MECDWWSLGAIMYEMLVGYPPFYADDPMSTCRKIVNW--KTHLK----FPEESRLS 403

  Fly   355 VNYRNLIESLVTNPSKRL---SYERIKNHPFFSEIPWGSIRSQVPPIIPTVRSDDDTSNFEDGIR 416
            ...|:||..|:.:.::||   ...:||.||:|..:.|..|.......||.|..|.||.|||    
plant   404 RGARDLIGKLLCSVNQRLGSTGASQIKAHPWFEGVQWEKIYQMEAAFIPEVNDDLDTQNFE---- 464

  Fly   417 HKTRREQGVAKKSLTTNMKSNDFSGKDLPFIGYSFVHME 455
             |...|....:....|.......|.||:.|:||::.:.|
plant   465 -KFDEEDNQTQAPSRTGPWRKMLSSKDINFVGYTYKNFE 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stiNP_001261768.1 PKc_like 111..452 CDD:304357 135/386 (35%)
S_TKc 113..383 CDD:214567 112/315 (36%)
Smc 487..1222 CDD:224117
CNH 1503..1774 CDD:279162
AT1G03920NP_001323295.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.