DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sti and AT4G33080

DIOPT Version :9

Sequence 1:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster
Sequence 2:NP_195034.2 Gene:AT4G33080 / 829445 AraportID:AT4G33080 Length:519 Species:Arabidopsis thaliana


Alignment Length:434 Identity:139/434 - (32%)
Similarity:218/434 - (50%) Gaps:94/434 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LKKRDRNIAEFVNKFRPIIEETRKLRVNADDFLIKTLIGQGYFGNVHLVVERQTNDIYAMKKIKK 146
            :|..:|...||:        ..::.:::.|||.:.|:||:|.||.|.|..||::.:||||||:||
plant    71 IKDLERKETEFM--------RLKRNKISVDDFELLTIIGRGAFGEVRLCRERKSGNIYAMKKLKK 127

  Fly   147 SVVT----TSQVKEERDIMSIRNSEWLINLQYAFQDNDNLYLVMEYMPGGDLLSLMSRHGPFDED 207
            |.:.    ...|:.||::::...|.:::.|.|:|||.:.|||:|||:||||:::|:.|.....||
plant   128 SEMVMRGQVEHVRAERNLLAEVESHYIVKLYYSFQDPEYLYLIMEYLPGGDMMTLLMREDTLRED 192

  Fly   208 LARFYLAELTVALHTLHEMGYVHRDIKPENILIDRFGHIKLADFGNAAALD-------------- 258
            :||||:|:..:|:.::|...|:||||||:|:|:|:.||:||:|||....||              
plant   193 VARFYIAQSVLAIESIHRYNYIHRDIKPDNLLLDKDGHMKLSDFGLCKPLDCRNLPSIQENRATD 257

  Fly   259 ----------------------------------RDGHVLSLSPVGTPDYIAPELLQTISTYKLS 289
                                              .:...|:.|.||||||||||:|       |.
plant   258 DETMSEPMDVDRCFPDTDNKRSWRSPQEQLQHWQMNRRKLAFSTVGTPDYIAPEVL-------LK 315

  Fly   290 KSMHDVSRIVSCDYWSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELISFPADLKVS 354
            |...     :.||:||:|.|.||::....||:.|:...|..||:      |.:..:.||.|.|.|
plant   316 KGYG-----MECDWWSLGAIMYEMLVGYPPFYADDPISTCRKIV------HWRNHLKFPEDAKFS 369

  Fly   355 VNYRNLIESLVTNPSKRL----SYERIKNHPFFSEIPWGSIRSQVPPIIPTVRSDDDTSNF---- 411
            ...::||..|:.|...||    ..::||:||:|.::.|..:........|.|..:.||.||    
plant   370 SEAKDLICRLLCNVDHRLGTGGGAQQIKDHPWFKDVVWEKLYEMEAAYKPEVNDELDTQNFMKFD 434

  Fly   412 EDGIRHKTRREQGVAKKSLTTNMKSNDFSGKDLPFIGYSFVHME 455
            |.......|...|:::|.|        .:.|||.|:||::.:.:
plant   435 EVNSPAPERTRSGLSRKML--------LAPKDLSFVGYTYKNFD 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stiNP_001261768.1 PKc_like 111..452 CDD:304357 135/400 (34%)
S_TKc 113..383 CDD:214567 114/325 (35%)
Smc 487..1222 CDD:224117
CNH 1503..1774 CDD:279162
AT4G33080NP_195034.2 STKc_NDR_like 92..467 CDD:270750 135/400 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.