DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sti and AT3G01085

DIOPT Version :9

Sequence 1:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster
Sequence 2:NP_001325617.1 Gene:AT3G01085 / 821283 AraportID:AT3G01085 Length:631 Species:Arabidopsis thaliana


Alignment Length:649 Identity:152/649 - (23%)
Similarity:240/649 - (36%) Gaps:215/649 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VNADDFLIKTLIGQGYFGNVHLVVERQTNDIYAMKKIKKSVVTTSQVK-EERDIMSIRNSEW--L 169
            :.|:||..:..||||.:.||....|..|..:.|:|||:.....|..:: ..|:||.:|..:.  :
plant   110 LRAEDFEKREKIGQGTYSNVFRACEVSTGRVMALKKIRIQNFETENIRFIAREIMILRRLDHPNI 174

  Fly   170 INLQ--YAFQDNDNLYLVMEYMPGGDLLSLMSRHGP---FDEDLARFYLAELTVALHTLHEMGYV 229
            :.|:  .|.::::::|.|.:||. .||..|.|  .|   |.|...:.|:.:|...:...|..|.:
plant   175 MKLEGIIASRNSNSMYFVFDYME-HDLEGLCS--SPDIKFTEAQIKCYMKQLLWGVEHCHLRGIM 236

  Fly   230 HRDIKPENILIDRFGHIKLADFGNA-AALDRDGHVLSLSPVGTPDYIAPELLQTISTYKLSKSMH 293
            |||||..|||::..|.:||||||.| ....|:.:.|: |.|.|..|.|||||...::|.      
plant   237 HRDIKAANILVNNKGVLKLADFGLANIVTPRNKNQLT-SRVVTLWYRAPELLMGSTSYS------ 294

  Fly   294 DVSRIVSCDYWSMGIIGYELI--------------------CETTP---FHEDNVHETYSKIL-- 333
                 ||.|.||:|.:..|::                    ...:|   |.|.|.....:|:.  
plant   295 -----VSVDLWSVGCVFAEILTGRPLLKGRTEIEQLHKIYKLSGSPDEEFWEKNKLHPQTKMFRP 354

  Fly   334 SHCEESHLKELI-SFPADLKVSVNYRNLIESLVT-NPSKRLSYERIKNHPFFSEIPWGSIRSQVP 396
            .|..|..|:|.. .||   |.::   ||:|:|:: :|.||.:........:|:..|:....|.:|
plant   355 QHQYEGCLRERFDEFP---KTAI---NLLENLLSIDPEKRGTASSALMSEYFNTQPYACDPSTLP 413

  Fly   397 PIIPTVRSDDDTSNFEDGIRHKTRREQGVAKKSLTTNMKSNDFSGKDLPFIGYSFVHMEKSAISA 461
            ...|                                                             
plant   414 KYPP------------------------------------------------------------- 417

  Fly   462 TTDEKLQEKLKELLQKLKTRENEISMLKQDLLRAQQSLRKTDNKSQVVADAKMEIKKLQQIIKEK 526
              ::::..|.:|.||:                |.:.|::|.||    :|..|:. |..:..:||.
plant   418 --NKEMDAKYREELQR----------------RRRVSIKKRDN----LATKKLG-KSRRATVKEP 459

  Fly   527 TMELTTCKTQIKTLQSSAKIDEEMWSKKEATITDLLRLNRQKYEEAKIASEQRYEKQLAD----- 586
            | .|....|..:|             ||||. |:::.....:..:|...||..| ..|:.     
plant   460 T-NLNRLPTHQET-------------KKEAE-TEIVVQTPSETSQATTRSEFPY-NSLSQTTAPA 508

  Fly   587 -----------KKQELASTLQKLDARELE-------------FNAKFEECK-----HLSMKLQNY 622
                       |:.::||||..:......             |.....|.|     |:|:   :.
plant   509 SGFAWAGTKKRKENDVASTLTYIQPGSASHVSGMSMAFAKNTFGLTINEDKPFLRPHVSL---DP 570

  Fly   623 KDMLQQIKEQNLKSETNHEEQRRQMAELYEQKLTDLRKKVRDSQDTNRRMTMEIKEI--RTELD 684
            .|:|       |.|..||::....|      .||:|....:..|      |..:.||  |||.|
plant   571 SDVL-------LFSGVNHKKTEEDM------DLTNLGANPKIFQ------TNGMNEILRRTESD 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stiNP_001261768.1 PKc_like 111..452 CDD:304357 95/376 (25%)
S_TKc 113..383 CDD:214567 89/305 (29%)
Smc 487..1222 CDD:224117 52/234 (22%)
CNH 1503..1774 CDD:279162
AT3G01085NP_001325617.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.