DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sti and Mad1l1

DIOPT Version :9

Sequence 1:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster
Sequence 2:NP_001102857.1 Gene:Mad1l1 / 680006 RGDID:1596881 Length:717 Species:Rattus norvegicus


Alignment Length:785 Identity:166/785 - (21%)
Similarity:311/785 - (39%) Gaps:194/785 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   683 LDESISSSKSTQEAKNATERNIEEILRRLNEEIASNNELHAEKVKLETKLQLKENETQEVRAECH 747
            ||.|.|:|.|.|:   ..|:|::  |....|:|.|.:.|                    ::.|..
  Rat    31 LDVSTSASGSLQK---QYEQNMQ--LEERAEQIRSKSYL--------------------IQVERE 70

  Fly   748 RLERELQLAECRCQLAESSLATQVSPYETAPGSLTELNAIEDQLRADLLAAKESENHQKGRADQL 812
            :::.||.....|.:| |.:.:|....||.......||.|...||:....||:|            
  Rat    71 KMQMELSHKRARVEL-ERAASTNARNYEREVDRNQELLARIRQLQEREAAAEE------------ 122

  Fly   813 QTLVTKLEQMLERFN--EQSLSPTKSHSSRKQEGETVGDMLERQNEKLEDKLAAVREQMIVERQA 875
                 |:.:.|||..  :|||                 |...:|..:.||.|||.||.:...:..
  Rat   123 -----KMREQLERHRLCKQSL-----------------DAASQQLREREDGLAAARETISSLKGR 165

  Fly   876 ARTANLSLWKVEKQLEEALSEKKLLARRMELTEDRIKKVQNASDEAQRMLKTSQEETRQRESRIE 940
            .....||....:.|::...|||:.|..::||.:   :|.|.|:.:.|. |:.||||...:|.:|:
  Rat   166 VSELQLSAMDQKVQVKRLESEKQELKEQLELQQ---RKWQEANQKIQE-LQASQEERTDQEQKIK 226

  Fly   941 ELKQEL------AAAKRDVLKEHRQWEKAEQERMKCKSEIIEHLANVHRLEQQETE--------- 990
            :|:|:|      ||..:.:..|..:..:.|:|..:.:.|      |.|..|.:||.         
  Rat   227 DLEQKLCLQEQDAAVVKSMKSELLRLPRMERELKRLREE------NTHLREMRETNGLLTEELEG 285

  Fly   991 LRQKL---RQIQSRFDGVTLEQKNTIRELQ--EEREKSRKANDSCLVLQKELKQLTDNFQRLKYA 1050
            |::||   .::|.....:.||::..:.:||  |:.:::...|   |...::|.:.....|:.:.|
  Rat   286 LQRKLGRQEKMQEALVDLELEKEKLLAKLQSWEKLDQTMGLN---LRTPEDLSRFVIELQQRELA 347

  Fly  1051 CSITDSQLTEVETMLKSEQERNKSQKSQLDTLHEKLRERNDQLTDLRKQLTTVESEKRLAEQRAQ 1115
            ....:|.:|.....|:..|::          |.:::|:.|.||.:.||:..|.|:..|..::|..
  Rat   348 LKEKNSSITSSARGLEKAQQQ----------LQDEVRQVNAQLLEERKKRETHEALARRLQKRNA 402

  Fly  1116 VLASEIDELRLNLKEQQKKLVAQQDQLVEQTNALFATQERAELLDGQNANYEAQTADSNREMVSL 1180
            :|..|.|.:|..|.....:| .|.:...:.|..::..::..:.:...::..|||.:.:       
  Rat   403 LLTKERDGMRAILGSYDSEL-TQAEYSPQLTQRMWEAEDMVQKVHAHSSEMEAQLSQA------- 459

  Fly  1181 KEENARILSELFHKKEEVGNLQAEIRGLESAQANLHAEIDSLQDTLAEKEQFYVQRDIKSNATLA 1245
                   |.||..:|:....|:.|::.|.:            |.:.||             |:..
  Rat   460 -------LEELGVQKQRADTLEMELKMLRA------------QTSSAE-------------ASFP 492

  Fly  1246 QHKKLIDYLQLKVEDLSAKKKKTLADK-----------LFGSSHTNKENVSPNDVESSILYRALK 1299
            ..|:.:|.|:||||:|..::.:...:|           |.|..:.::..|....:..:.:.|   
  Rat   493 FCKEEVDALRLKVEELEGERSRLEQEKQALEMQMERLTLQGDYNQSRTKVLHMSLNPASMAR--- 554

  Fly  1300 EELKREQKMNSLLKEQLAQLNGTATLRSPRKSAAVNGDSDAPKQRPVSIAALPRSPQKQQQPLKR 1364
               :|:::.:..|:|:..:|.|  .:.:..:...:..|.:|....|.|         |:...|::
  Rat   555 ---QRQREDHDRLQEECERLRG--LVHALERGGPIPADLEAASSLPSS---------KEVAELRK 605

  Fly  1365 TTSQVELKTTAEKPT------------------KVTIENQAHHRFELALQESKVDAVNCVVCEKA 1411
            .....|||....|..                  ::.:..::.:|......|.:.|   |::.:..
  Rat   606 QVESAELKNQRLKEVFQTKIQEFRKVCYTLTGYQIDVTTESQYRLTSRYAEHQTD---CLIFKAT 667

  Fly  1412 VVAGS 1416
            ..:||
  Rat   668 GPSGS 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stiNP_001261768.1 PKc_like 111..452 CDD:304357
S_TKc 113..383 CDD:214567
Smc 487..1222 CDD:224117 128/560 (23%)
CNH 1503..1774 CDD:279162
Mad1l1NP_001102857.1 MAD 54..715 CDD:283261 156/757 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.