DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sti and stk38l

DIOPT Version :9

Sequence 1:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster
Sequence 2:XP_005164924.1 Gene:stk38l / 393957 ZFINID:ZDB-GENE-040426-798 Length:464 Species:Danio rerio


Alignment Length:422 Identity:133/422 - (31%)
Similarity:217/422 - (51%) Gaps:78/422 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 DKDTLKKRD---RNIAEFVNKFRPIIEETRKLRVNADDFLIKTLIGQGYFGNVHLVVERQTNDIY 139
            |::...:|.   |...||:        ..::.|:..|||....:||:|.||.|.||.::.|..||
Zfish    60 DEEKSMRRSLHARKETEFL--------RLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIY 116

  Fly   140 AMKKIKKSVV----TTSQVKEERDIMSIRNSEWLINLQYAFQDNDNLYLVMEYMPGGDLLSLMSR 200
            |||.::|:.:    ..:.::.||||:...:..|::.:.|:|||..||||:||::||||:::|:.:
Zfish   117 AMKILRKADMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMK 181

  Fly   201 HGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENILIDRFGHIKLADFG------------- 252
            .....|:..:||:||..:|:.::|::|::||||||:|:|:|..||:||:|||             
Zfish   182 KDTLSEEATQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSRGHVKLSDFGLCTGLKKAHRTEF 246

  Fly   253 ---------------------NAAALDRDGHVLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVS 296
                                 .|....::...|:.|.||||||||||:.......||        
Zfish   247 YRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGYNKL-------- 303

  Fly   297 RIVSCDYWSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELISFPADLKVSVNYRNLI 361
                ||:||:|:|.||::....||..:...|||.|::      :.:|.::||.::.:|...:.||
Zfish   304 ----CDWWSLGVIMYEMLIGYPPFCSETPQETYRKVM------NWRETLTFPPEVPISERAKELI 358

  Fly   362 ESLVTNPSKRL---SYERIKNHPFFSEIPWGSIRSQVPPIIPTVRSDDDTSNFEDGIRHKTRREQ 423
            ....|:...|:   |.:.||:||||..:.|..||.:...|...::|.||||||:|      ..|.
Zfish   359 LRYCTDAENRIGSGSVDEIKSHPFFESVDWEHIRERPAAISIDIKSIDDTSNFDD------FPES 417

  Fly   424 GVAKKSLTTNMKSNDFSGKDLPFIGYSFVHME 455
            .:.:.  ..|:..:||..||..|:.|::...|
Zfish   418 DILQP--VANVTESDFKSKDWVFLNYTYKRFE 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stiNP_001261768.1 PKc_like 111..452 CDD:304357 126/381 (33%)
S_TKc 113..383 CDD:214567 102/310 (33%)
Smc 487..1222 CDD:224117
CNH 1503..1774 CDD:279162
stk38lXP_005164924.1 STKc_NDR2 87..452 CDD:270776 127/387 (33%)
S_TKc 90..383 CDD:214567 102/310 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.