DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sti and Lats1

DIOPT Version :9

Sequence 1:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster
Sequence 2:NP_001128015.2 Gene:Lats1 / 308265 RGDID:1564085 Length:1130 Species:Rattus norvegicus


Alignment Length:394 Identity:142/394 - (36%)
Similarity:194/394 - (49%) Gaps:97/394 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 CDKDT----LKKRDRNIAEFVNKFRPIIEETRKLRVNADDFLIKTLIGQGYFGNVHLVVERQTND 137
            |.|::    ||:...:.:.||.                    |||| |.|.||.|.|..:..|..
  Rat   686 CQKESNYIRLKRAKMDKSMFVK--------------------IKTL-GIGAFGEVCLARKVDTKA 729

  Fly   138 IYAMKKI-KKSVVTTSQ---VKEERDIMSIRNSEWLINLQYAFQDNDNLYLVMEYMPGGDLLSLM 198
            :||.|.: ||.|:..:|   ||.||||::..::||::.|.|:|||.||||.||:|:||||::||:
  Rat   730 LYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLL 794

  Fly   199 SRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENILIDRFGHIKLADFG----------- 252
            .|.|.|.|:|||||:||||.|:.::|:||::||||||:||||||.|||||.|||           
  Rat   795 IRMGIFPENLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDS 859

  Fly   253 ------------------------NAAALDR-----------DGHVLSLSPVGTPDYIAPELLQT 282
                                    |....||           ....|:.|.||||:|||||:|..
  Rat   860 KYYQSGDHPRQDSMDFSSEWGDPSNCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLLR 924

  Fly   283 ISTYKLSKSMHDVSRIVSCDYWSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELISF 347
            ....:|            ||:||:|:|.:|::....||......||..|:::.....|:      
  Rat   925 TGYTQL------------CDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHI------ 971

  Fly   348 PADLKVSVNYRNLIESLVTNPSKRL---SYERIKNHPFFSEIPWGS-IRSQVPPIIPTVRSDDDT 408
            |...|:|....:||..|...|..||   ..:.||.||||..|.:.| :|.|....||.:....||
  Rat   972 PPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDT 1036

  Fly   409 SNFE 412
            |||:
  Rat  1037 SNFD 1040

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stiNP_001261768.1 PKc_like 111..452 CDD:304357 136/356 (38%)
S_TKc 113..383 CDD:214567 123/322 (38%)
Smc 487..1222 CDD:224117
CNH 1503..1774 CDD:279162
Lats1NP_001128015.2 UBA_like_SF 103..143 CDD:419673
PHA03247 <183..590 CDD:223021
STKc_LATS1 703..1084 CDD:270775 138/377 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.