DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sti and NBPF15

DIOPT Version :9

Sequence 1:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster
Sequence 2:NP_001372377.1 Gene:NBPF15 / 284565 HGNCID:28791 Length:698 Species:Homo sapiens


Alignment Length:628 Identity:127/628 - (20%)
Similarity:250/628 - (39%) Gaps:166/628 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   564 LNRQKYEEAKIASEQRYEKQLADKKQELASTLQK---------LDARELEFNAKFEECKHL-SMK 618
            |:.:|.|...:...::...|||:|||:..:..:|         |..|:.::  |:||||.| ...
Human     8 LSSEKAEMNILEINEKLRPQLAEKKQQFRNLKEKCFLTQLAGFLANRQKKY--KYEECKDLIKFM 70

  Fly   619 LQNYKDMLQQIKEQNLKSETNHEEQRRQ---MAELYEQKLTDLRKKVRDSQDTNRRMTMEIKEIR 680
            |:|.:    |.||:.|..:....|:.||   :....|::||.||:|:|:.:|.:|.:...::.:.
Human    71 LRNER----QFKEEKLAEQLKQAEELRQYKVLVHAQERELTQLREKLREGRDASRSLNEHLQALL 131

  Fly   681 TELDESISSSKSTQEAKNATERNIEEILRRLNEEIASNNELHAEKVKLETKLQLKENETQEVRAE 745
            |..:...|..:..||......|..:.::::|:.| ..|::....:|::..|:|......:..:||
Human   132 TPDEPDKSQGQDLQEQLAEGCRLTQHLVQKLSPE-NDNDDDEDVQVEVAEKVQKSSAPREMQKAE 195

  Fly   746 CHRLEREL---QLAECRCQLAESSLATQVSPYET-APGSLTELNAIEDQLRADLLAAKESENHQK 806
                |:|:   .|.||....:.|.     .||:: .|...|::...||::.:.|:.   |.:|.:
Human   196 ----EKEVPEDSLEECAITCSNSH-----GPYDSNQPHKKTKITFEEDKVDSTLIG---SSSHVE 248

  Fly   807 GRADQLQTLVTKLEQMLERFNEQSLSPTKSHSSRKQEGETVGDMLERQNEKLEDKLAAVREQMIV 871
            .                    |.::.....:.|..:|.|..|.:..|..::..:..:        
Human   249 W--------------------EDAVHIIPENESDDEEEEEKGPVSPRGMDEAGNHHS-------- 285

  Fly   872 ERQAARTANLSLWKVEKQLEEALSEKKLLARRMELTEDRIKKVQNASDEAQRMLKTSQEETRQRE 936
            ::..|||.|        |:...|:.:.|                                   :|
Human   286 QQTIARTKN--------QIPHVLTHRNL-----------------------------------QE 307

  Fly   937 SRIEELKQELAAAKRDVLKEHRQWEKAEQERMKCKSEII----EHLANVHRLEQQETELRQKLRQ 997
            |..||:.||             .|::. ...:....|::    .:.:..|.||:|:..:...:. 
Human   308 SEEEEVPQE-------------SWDEG-YSTLSIPPEMLASYQSYSSTFHSLEEQQVCMAVDIG- 357

  Fly   998 IQSRFDGVTLEQKNTI-----RELQEEREKS--RKANDSCLVLQKELKQLTDNFQRLKYACSITD 1055
             :.|:|.|..|.:...     |||.:|:|..  :.:.|.|........:|||:.|..:.|..:.:
Human   358 -RHRWDQVKKEDQEATGPRLSRELLDEKEPEVLQDSLDRCYSTPSGCLELTDSCQPYRSAFYVLE 421

  Fly  1056 SQ-------LTEVETMLKSEQERNKS-QKSQLDTLHEK----LRERND----------QLTDLRK 1098
            .|       :.|:|...:.|::::.| .:...:.|.||    |::..|          :|.||.:
Human   422 QQRVGLAIDMDEIEKYQEVEEDQDPSCPRLSRELLDEKEPEVLQDSLDRCYSTPSDYLELPDLGQ 486

  Fly  1099 QLTTVESEKRLAEQRAQVLASEIDELRLNLKEQQKKLVAQQDQ 1141
            ..:   |.....|::...||.::|.::   |:|::    ::||
Human   487 PYS---SAVYSLEEQYLGLALDVDRIK---KDQEE----EEDQ 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stiNP_001261768.1 PKc_like 111..452 CDD:304357
S_TKc 113..383 CDD:214567
Smc 487..1222 CDD:224117 127/628 (20%)
CNH 1503..1774 CDD:279162
NBPF15NP_001372377.1 DUF1220 179..240 CDD:399619 16/69 (23%)
DUF1220 <316..353 CDD:399619 7/50 (14%)
DUF1220 366..429 CDD:399619 14/62 (23%)
DUF1220 439..504 CDD:399619 13/67 (19%)
DUF1220 514..579 CDD:399619 2/10 (20%)
DUF1220 610..672 CDD:399619
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.