DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sti and STK38L

DIOPT Version :9

Sequence 1:NP_001261768.1 Gene:sti / 39429 FlyBaseID:FBgn0002466 Length:1858 Species:Drosophila melanogaster
Sequence 2:XP_024304657.1 Gene:STK38L / 23012 HGNCID:17848 Length:521 Species:Homo sapiens


Alignment Length:495 Identity:144/495 - (29%)
Similarity:220/495 - (44%) Gaps:141/495 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 AICREGLLDAFCLLYNECDKDTLKKRDRNIAEFVNKFRPIIEETRKLRVNADDFLIKTLIGQGYF 124
            |:..|||.|       |..|....:..|...||:        ..::.|:..|||....:||:|.|
Human    52 AMEEEGLAD-------EEKKLRRSQHARKETEFL--------RLKRTRLGLDDFESLKVIGRGAF 101

  Fly   125 GNVHLVVERQTNDIYAMKKIKKSVV----TTSQVKEERDIMSIRNSEWLINLQYAFQDNDNLYLV 185
            |.|.||.::.|..|||||.::||.:    ..:.::.||||:...:..|::.:.|:|||..||||:
Human   102 GEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLI 166

  Fly   186 MEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENILIDRFGHIKLAD 250
            ||::||||:::|:.:.....|:..:||::|..:|:..:|::|::||||||:|:|:|..||:||:|
Human   167 MEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSD 231

  Fly   251 FGNAAALD-----------------------------------RDGHVLSLSP------------ 268
            ||....|.                                   |:..||||||            
Human   232 FGLCTGLKKAHRTEFYRNLTHNPPSDFCKFGCCFSSFPWLRYCREQKVLSLSPLLNPLCFRCICI 296

  Fly   269 --------------------------------------------VGTPDYIAPELLQTISTYKLS 289
                                                        ||||||||||:.......|| 
Human   297 FFLWRAFFPRDYNSILLKLAFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGYNKL- 360

  Fly   290 KSMHDVSRIVSCDYWSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELISFPADLKVS 354
                       ||:||:|:|.||::....||..:...|||.|::      :.||.:.||.::.:|
Human   361 -----------CDWWSLGVIMYEMLIGYPPFCSETPQETYRKVM------NWKETLVFPPEVPIS 408

  Fly   355 VNYRNLIESLVTNPSKRL---SYERIKNHPFFSEIPWGSIRSQVPPIIP-TVRSDDDTSNFEDGI 415
            ...::||.....:...|:   ..|.||.||||..:.|..||.: |..|| .::|.||||||:|  
Human   409 EKAKDLILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRER-PAAIPIEIKSIDDTSNFDD-- 470

  Fly   416 RHKTRREQGVAKKSLTTNMKSNDFSGKDLPFIGYSFVHME 455
                ..|..:.:.  ..|....|:..||..|:.|::...|
Human   471 ----FPESDILQP--VPNTTEPDYKSKDWVFLNYTYKRFE 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stiNP_001261768.1 PKc_like 111..452 CDD:304357 132/439 (30%)
S_TKc 113..383 CDD:214567 107/367 (29%)
Smc 487..1222 CDD:224117
CNH 1503..1774 CDD:279162
STK38LXP_024304657.1 STKc_NDR2 87..509 CDD:270776 133/445 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D759391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.